Allergen

ADK92390.1

Accession ADK92390.1
External DB Link NCBI Protein
Species Dermatophagoides pteronyssinus
Common Name house dust mite
Description fatty acid-binding protein
IUIS Name Der p 13
Length 131
Year Adopted 2012
Sequence >ADK92390.1 Der p 13; fatty acid-binding protein [Dermatophagoides pteronyssinus]
MASIEGKYKLEKSEKFDEFLDKLGVGFMVKTAAKTLKPTFEVAKENDQYVFRSLSTFKNT
EIKFKLGEEFEEDRADGKRVKTVINKDGDNKFVQTQFGDKEVKIVREFNGDEVVVTASCD
GVTSVRTYKRI
Parent Accession

Related Articles

Pubmed Authors Title Journal
16585580 Chan,S.L.; Ong,S.T.; Ong,S.Y.; Chew,F.T.; Mok,Y.K.; Nuclear magnetic resonance structure-based epitope mapping and modulation of dust mite group 13 allergen as a hypoallergen J. Immunol. 176 (8), 4852-4860 (2006)
16741365 Batard T; Hrabina A; Bi XZ; Chabre H; Lemoine P; Couret MN; Faccenda D; Villet B; Harzic P; André F; Goh SY; André C; Chew FT; Moingeon P Production and proteomic characterization of pharmaceutical-grade Dermatophagoides pteronyssinus and Dermatophagoides farinae extracts for allergy vaccines. Int Arch Allergy Immunol. 2006;140(4):295-305
21332797 Kidon MI; Chiang WC; Liew WK; Ong TC; Tiong YS; Wong KN; Angus AC; Ong ST; Gao YF; Reginald K; Bi XZ; Shang HS; Chew FT Mite component-specific IgE repertoire and phenotypes of allergic disease in childhood: the tropical perspective. Pediatr Allergy Immunol. 2011 Mar;22(2):202-10