Allergen

ADR66943.1

Accession ADR66943.1
External DB Link NCBI Protein
Species Prunus avium
Common Name cherry
Description lipid transfer protein
IUIS Name Pru av 3
Length 117
Year Adopted 2012
Sequence >ADR66943.1 Pru av 3; lipid transfer protein [Prunus avium]
MACSAMTKLALVVALCMVVSVPIAQALTCGQVSSNLAPCIPYVRGGGAVPPACCNGIRNI
NNLAKTTADRQTACNCLKQLSASVPGVNANNAAALPGKCGVNVPYKISPSTNCATVK
Parent Accession

Related Articles

Pubmed Authors Title Journal
11419731 Pastorello,E.A.; Farioli,L.; Pravettoni,V.; Giuffrida,M.G.; Ortolani,C.; Fortunato,D.; Trambaioli,C.; Scibola,E.; Calamari,A.M.; Robino,A.M.; Conti,A. Characterization of the major allergen of plum as a lipid transfer protein J. Chromatogr. B Biomed. Sci. Appl. 756 (1-2), 95-103 (2001)
11295665 Scheurer,S.; Pastorello,E.A.; Wangorsch,A.; Kastner,M.; Haustein,D.; Vieths,S. Recombinant allergens Pru av 1 and Pru av 4 and a newly identified lipid transfer protein in the in vitro diagnosis of cherry allergy J. Allergy Clin. Immunol. 107 (4), 724-731 (2001)
12642848 Diaz-Perales A; Sanz ML; Garcia-Casado G; Sanchez-Monge R; Garcia-Selles FJ; Lombardero M; Polo F; Gamboa PM; Barber D; Salcedo G Recombinant Pru p 3 and natural Pru p 3, a major peach allergen, show equivalent immunologic reactivity: a new tool for the diagnosis of fruit allergy. J Allergy Clin Immunol. 2003 Mar;111(3):628-33
10669861 Pastorello EA; D Evidence for a lipid transfer protein as the major allergen of apricot. J Allergy Clin Immunol. 2000 Feb;105(2 Pt 1):371-7
15970634 Zuidmeer L; van Leeuwen WA; Budde IK; Cornelissen J; Bulder I; Rafalska I; Besoli NT; Akkerdaas JH; Asero R; Rivas MF; Mancebo EG; van Ree R Lipid transfer proteins from fruit: cloning, expression and quantification. Int Arch Allergy Immunol. 2005 Aug;137(4):273-81
12065911 Garcia-Selles FJ; Diaz-Perales A; Sanchez-Monge R; Alcantara M; Lombardero M; Barber D; Salcedo G; Fernandez-Rivas M Patterns of reactivity to lipid transfer proteins of plant foods and Artemisia pollen: an in vivo study. Int Arch Allergy Immunol. 2002 Jun;128(2):115-22
21168554 Röder M; Vieths S; Holzhauser T Sensitive and specific detection of potentially allergenic almond (Prunus dulcis) in complex food matrices by Taqman(®) real-time polymerase chain reaction in comparison to commercially available protein-based enzyme-linked immunosorbent assay. Anal Chim Acta. 2011 Jan 24;685(1):74-83
19655801 Sathe SK; Venkatachalam M; Sharma GM; Kshirsagar HH; Teuber SS; Roux KH Solubilization and electrophoretic characterization of select edible nut seed proteins. J Agric Food Chem. 2009 Sep 9;57(17):7846-56