Allergen

ADW27428.1

Accession ADW27428.1
External DB Link NCBI Protein
Species Fagopyrum tataricum
Common Name Tataricum buckwheat
Description 2S albumin, conglutin
IUIS Name Fag t 2
Length 149
Year Adopted 2012
Sequence >ADW27428.1 Fag t 2; 2S albumin, conglutin [Fagopyrum tataricum]
MKLFIILATATLLIAATQAKYLRDEGFDLGETQMSSKCTRQVKMMEPELVKCNRYIAMDI
MDDKYEEALSRIQGEGCESEEKFLRGCCVAMKEMEDECVCEWMKMMVENQKGRIGETLMR
KGIRDLKELPNKCGISEMECHSRGNWYYV
Parent Accession

Related Articles

Pubmed Authors Title Journal
11097313 Park,J.W.; Kang,D.B.; Kim,C.W.; Koh,S.H.; Yum,H.Y.; Kim,K.E.; Hong,C.S.; Lee,K.Y.; Identification and characterization of the major allergens of buckwheat Allergy 55 (11), 1035-1041 (2000)
12372998 Tanaka K; Matsumoto K; Akasawa A; Nakajima T; Nagasu T; Iikura Y; Saito H Pepsin-resistant 16-kD buckwheat protein is associated with immediate hypersensitivity reaction in patients with buckwheat allergy. Int Arch Allergy Immunol. 2002 Sep;129(1):49-56
16549935 Koyano S; Takagi K; Teshima R; Sawada JI Molecular Cloning of cDNA, Recombinant Protein Expression and Characterization of a Buckwheat 16-kDa Major Allergen. Int Arch Allergy Immunol. 2006 Mar 16;140(1):73-81
18520034 Satoh R; Koyano S; Takagi K; Nakamura R; Teshima R; Sawada J Immunological characterization and mutational analysis of the recombinant protein BWp16, a major allergen in buckwheat. Biol Pharm Bull. 2008 Jun;31(6):1079-85
21645012 Chen P; Guo YF; Yan Q; Li YH Molecular cloning and characterization of Fag t 2: a 16-kDa major allergen from Tartary buckwheat seeds. Allergy. 2011 Oct;66(10):1393-5