Allergen

AGC39174.1

Accession AGC39174.1
External DB Link NCBI Protein
Species Actinidia arguta
Common Name hardy kiwi
Description kiwellin
IUIS Name
Length 213
Year Adopted 2014
Sequence >AGC39174.1 kiwellin [Actinidia arguta]
MAQLTLLLLSLFLTLISLPPPGASISSCNGPCRDLNDCDGQLICIKGKCNDDPEVGTHIC
GGTTPSPQPGGCNPSGTLTCQGKSYPTYDCSPPVTSSTPAKLTNNDFSEGGDGGGPSECD
ESYHSNNERIVALSTGWYNGGSRCGKMIRITASNGKSVSAKVVDECDSRHGCDKEHAGQP
PCRNNIVDGSNAVWSALGLDKNVGVVDITWSMA
Parent Accession

Related Articles

Pubmed Authors Title Journal
16328735 Tamburrini,M.; Cerasuolo,I.; Carratore,V.; Stanziola,A.A.; Zofra,S.; Romano,L.; Camardella,L.; Ciardiello,M.A.; Kiwellin, a novel protein from kiwi fruit. Purification, biochemical characterization and identification as an allergen* Protein J. 24 (7-8), 423-429 (2005)
18442249 Tuppo,L.; Giangrieco,I.; Palazzo,P.; Bernardi,M.L.; Scala,E.; Carratore,V.; Tamburrini,M.; Mari,A.; Ciardiello,M.A.; Kiwellin, a modular protein from green and gold kiwi fruits: evidence of in vivo and in vitro processing and IgE binding J. Agric. Food Chem. 56 (10), 3812-3817 (2008)
23289429 Maddumage,R.; Nieuwenhuizen,N.J.; Bulley,S.M.; Cooney,J.M.; Green,S.A.; Atkinson,R.G.; Diversity and relative levels of actinidin, kiwellin, and thaumatin-like allergens in 15 varieties of kiwifruit (Actinidia) J. Agric. Food Chem. 61 (3), 728-739 (2013)
20825426 Bernardi ML; Picone D; Tuppo L; Giangrieco I; Petrella G; Palazzo P; Ferrara R; Tamburrini M; Mari A; Ciardiello MA Physico-chemical features of the environment affect the protein conformation and the immunoglobulin E reactivity of kiwellin (Act d 5). Clin Exp Allergy. 2010 Dec;40(12):1819-26