Allergen

AGC60030.1

Accession AGC60030.1
External DB Link NCBI Protein
Species Anisakis simplex
Common Name parasitic fish worm
Description unknown function
IUIS Name Ani s 12
Length 264
Year Adopted 2014
Sequence >AGC60030.1 Ani s 12; unknown function [Anisakis simplex]
MVKNLPPSVREQCIESQIVIRDCEEKKYGENCAELIKQCVTITGAPPVTIGGSGQYRVAT
SLRDCIKKGGYMGYCKTFTTEENCIKWKDECAPSEAAEKTDENSLEVFPETFSQCFKSQV
VMQQCMNEGEEECSKIQKECVDAFGTPPVTYAANGAYQMAAPLHRCIENGGWMKMCSTWI
NATICERWKQECSGDKDAELPPNFSQCIQTQMVMLQCNLKFGDKCKALQEECVAATDAPT
VDANPPIFTSKMIRCVKRKMAKGL
Parent Accession

Related Articles

Pubmed Authors Title Journal
21262386 Kobayashi,Y.; Ohsaki,K.; Ikeda,K.; Kakemoto,S.; Ishizaki,S.; Shimakura,K.; Nagashima,Y.; Shiomi,K.; Identification of novel three allergens from Anisakis simplex by chemiluminescent immunoscreening of an expression cDNA library Parasitol. Int. (2011) In press
23092000 Pravettoni V; Primavesi L; Piantanida M Anisakis simplex: current knowledge. Eur Ann Allergy Clin Immunol. 2012 Aug;44(4):150-6
23742817 Quiazon KM; Zenke K; Yoshinaga T Molecular characterization and comparison of four Anisakis allergens between Anisakis simplex sensu stricto and Anisakis pegreffii from Japan. Mol Biochem Parasitol. 2013 Jul;190(1):23-6
23089975 Iijima S; Moriyama T; Ichikawa H; Kobayashi Y; Shiomi K [A case of an allergic reaction due to Anisakis simplex possibly after the ingestion of squid--successful detection of four A. simplex allergens, Ani s 1, Ani s 2, Ani s 12 and troponin C-like protein]. Arerugi. 2012 Aug;61(8):1104-10
23724976 del Carmen Romero M; Valero A; Navarro-Moll MC; Martín-Sánchez J Experimental comparison of pathogenic potential of two sibling species Anisakis simplex s.s. and Anisakis pegreffii in Wistar rat. Trop Med Int Health. 2013 Aug;18(8):979-84