Allergen

AGC60035.1

Accession AGC60035.1
External DB Link NCBI Protein
Species Anisakis simplex
Common Name parasitic fish worm
Description serine protease inhibitor
IUIS Name Ani s 1
Length 163
Year Adopted 2014
Sequence >AGC60035.1 Ani s 1; serine protease inhibitor [Anisakis simplex]
MDKGTPCTQEGGVKPSVAWWHDDKTGICLSFKYTGCGGNANRFTTIKNCEQHCKMPDRGA
CALGKKPAEDSNGEQLVCAGMREDKCPNGYQCKMMAFMGLCCPTKEEELFAREYEGVCKS
GKPVKMDRGSGWMMTILGKSCDDQFCPEDAKCEQGKLFANCCK
Parent Accession

Related Articles

Pubmed Authors Title Journal
10887322 Moneo I; Caballero ML; Gomez F; Ortega E; Alonso MJ Isolation and characterization of a major allergen from the fish parasite Anisakis simplex. J Allergy Clin Immunol. 2000 Jul;106(1 Pt 1):177-82
15287588 Shimakura K; Miura H; Ikeda K; Ishizaki S; Nagashima Y; Shirai T; Kasuya S; Shiomi K Purification and molecular cloning of a major allergen from Anisakis simplex. Mol Biochem Parasitol. 2004 May;135(1):69-75
17537527 Rodriguez-Perez R; Caballero ML; Gonzalez-Munoz M; Rodriguez-Mahillo A; Moneo I Cloning and expression of a biologically active Anisakis simplex allergen Ani s 1 in the yeast Pichia pastoris. Mol Biochem Parasitol. 2007 Jul;154(1):115-8
23095317 Ventura MT; Napolitano S; Menga R; Cecere R; Asero R Anisakis simplex Hypersensitivity Is Associated with Chronic Urticaria in Endemic Areas. Int Arch Allergy Immunol. 2012 Oct 18;160(3):297-300
23092000 Pravettoni V; Primavesi L; Piantanida M Anisakis simplex: current knowledge. Eur Ann Allergy Clin Immunol. 2012 Aug;44(4):150-6
22448449 Gamboa PM; Asturias J; Martínez R; Antépara I; Jáuregui I; Urrutia I; Fernández J; Sanz ML Diagnostic utility of components in allergy to Anisakis simplex. J Investig Allergol Clin Immunol. 2012;22(1):13-9
23742817 Quiazon KM; Zenke K; Yoshinaga T Molecular characterization and comparison of four Anisakis allergens between Anisakis simplex sensu stricto and Anisakis pegreffii from Japan. Mol Biochem Parasitol. 2013 Jul;190(1):23-6
23089975 Iijima S; Moriyama T; Ichikawa H; Kobayashi Y; Shiomi K [A case of an allergic reaction due to Anisakis simplex possibly after the ingestion of squid--successful detection of four A. simplex allergens, Ani s 1, Ani s 2, Ani s 12 and troponin C-like protein]. Arerugi. 2012 Aug;61(8):1104-10
23724976 del Carmen Romero M; Valero A; Navarro-Moll MC; Martín-Sánchez J Experimental comparison of pathogenic potential of two sibling species Anisakis simplex s.s. and Anisakis pegreffii in Wistar rat. Trop Med Int Health. 2013 Aug;18(8):979-84