Allergen

ANW10058.1

Accession ANW10058.1
External DB Link NCBI Protein
Species Rastrelliger kanagurta
Common Name Indian mackerel
Description calcium-binding protein, parvalbumin
IUIS Name Ras k 1
Length 109
Year Adopted 2019
Sequence >ANW10058.1 Ras k 1; calcium-binding protein, parvalbumin [Rastrelliger kanagurta]
MAFASVLKDAEITAALDGCKADGSFDHKKFFKACGLAGKSGDDVKKAFAIIDQDKSGFIE
EEELKLFLQNFKAGARTLSDAETKAFLKAGDTDGDGKIGVDEFAAMIKG
Parent Accession

Related Articles

Pubmed Authors Title Journal
29193486 Ruethers T, Raith M, Sharp MF, Koeberl M, Stephen JN, Nugraha R, Le TTK, Quirce S, Nguyen HXM, Kamath SD, Mehr SS, Campbell DE, Bridges CR, Taki AC, Swoboda I, Lopata AL Characterization of Ras k 1 a novel major allergen in Indian mackerel and identification of parvalbumin as the major fish allergen in 33 Asia-Pacific fish species Clin Exp Allergy. 2018 Apr;48(4):452-463