Allergen

BAA74451.1

Accession BAA74451.1
External DB Link NCBI Protein
Species Vigna radiata
Common Name mung bean
Description pathogenesis related protein, PR-10, Bet v 1-like
IUIS Name Vig r 6
Length 155
Year Adopted 2014
Sequence >BAA74451.1 Vig r 6; pathogenesis related protein, PR-10, Bet v 1-like [Vigna radiata]
MVKEFNTQTELSVRLEALWAVLSKDFITVVPKVLPHIVKDVQLIEGDGGVGTILIFNFLP
EVSPSYQREEITEFDESSHEIGLQVIEGGYLNQGLSYYKTTFKLSEIEEDKTLVNVKISY
DHDSDIEEKVTPTKTSQSTLMYLRRLERYLSNGSA
Parent Accession

Related Articles

Pubmed Authors Title Journal
9874249 Fujimoto,Y.; Nagata,R.; Fukasawa,H.; Yano,K.; Azuma,M.; Iida,A.; Sugimoto,S.; Shudo,K.; Hashimoto,Y.; Purification and cDNA cloning of cytokinin-specific binding protein from mung bean (Vigna radiata) Eur. J. Biochem. 258 (2), 794-802 (1998)
23996905 Guhsl EE; Hofstetter G; Hemmer W; Ebner C; Vieths S; Vogel L; Breiteneder H; Radauer C Vig r 6, the cytokinin-specific binding protein from mung bean (Vigna radiata) sprouts, cross-reacts with Bet v 1-related allergens and binds IgE from birch pollen allergic patients Mol Nutr Food Res. 2013 Sep 1;