Allergen

BAC76688.1

Accession BAC76688.1
External DB Link NCBI Protein
Species Triticum aestivum
Common Name wheat
Description thiol reductase
IUIS Name Tri a 27
Length 203
Year Adopted 2007
Sequence >BAC76688.1 Tri a 27; thiol reductase [Triticum aestivum]
GDVATGRGSEKVHVAIYYESLCPYSVRFVANHLFKAYRDGLLDAANLTLVPYGNAVVRND
GTISCQHGPEECLLNTVEACAIDAWPDVKVHLGFIYCVSDLVLKNKHREWESCFQKQGLD
PKPVTECYKGERGHNLSLEYGRQTAELVPPHQFVPWVVVDGKPLYNDYGNFKAYICKAYK
GYPLLEACRSLGLEAHDDVYGRL
Parent Accession

Related Articles

Pubmed Authors Title Journal
21557753 Sander I; Rozynek P; Rihs HP; van Kampen V; Chew FT; Lee WS; Kotschy-Lang N; Merget R; Brüning T; Raulf-Heimsoth M Multiple wheat flour allergens and cross-reactive carbohydrate determinants bind IgE in baker Allergy. 2011 Sep;66(9):1208-15
19129651 Kimoto M; Suzuki M; Komiyama N; Kunimoto A; Yamashita H; Hiemori M; Takahashi K; Tsuji H Isolation and molecular cloning of a major wheat allergen, Tri a Bd 27K. Biosci Biotechnol Biochem. 2009 Jan;73(1):85-92
19734669 Komiyama N; Hiemori M; Kimoto M; Suzuki M; Yamashita H; Takahashi Y; Tsuji H Preparation and epitope mapping of a monoclonal antibody against Tri a Bd 27K, a major wheat allergen. Biosci Biotechnol Biochem. 2009 Sep;73(9):2113-6
20057126 Hiemori M; Yosida Y; Kimoto M; Yamashita H; Takahashi K; Takahashi K; Komiyama N; Tsuji H Investigation of multiple forms of Tri a Bd 27K, a major wheat allergen, by immunoblotting analysis. Biosci Biotechnol Biochem. 2010;74(1):199-202