Allergen

BAD36780.1

Accession BAD36780.1
External DB Link NCBI Protein
Species Myrmecia banksi
Common Name giant bull ant
Description pilosulin
IUIS Name Myr p 3
Length 84
Year Adopted 2015
Sequence >BAD36780.1 Myr p 3; pilosulin [Myrmecia banksi]
MKLSCLLLTLAIIFVLTIVHAPNVKAKALADPESDAVGFADAVGEADPFDITKLNIKKLT
KATCKVISKGASMCKVLFDKKKQE
Parent Accession

Related Articles

Pubmed Authors Title Journal
8866004 Donovan,G.R.; Street,M.D.; Tetaz,T.; Smith,A.I.; Alewood,D.; Alewood,P.; Sutherland,S.K.; Baldo,B.A.; Expression of jumper ant (Myrmecia pilosula) venom allergens: post-translational processing of allergen gene products Biochem. Mol. Biol. Int. 39 (5), 877-885 (1996)
17933477 Wiese MD; Milne RW; Davies NW; Chataway TK; Brown SG; Heddle RJ Myrmecia pilosula (Jack Jumper) ant venom: validation of a procedure to standardise an allergy vaccine. J Pharm Biomed Anal. 2008 Jan 7;46(1):58-65
17362256 Wiese MD; Brown SG; Chataway TK; Davies NW; Milne RW; Aulfrey SJ; Heddle RJ Myrmecia pilosula (Jack Jumper) ant venom: identification of allergens and revised nomenclature. Allergy. 2007 Apr;62(4):437-43
15246874 Inagaki,H.; Akagi,M.; Imai,H.T.; Taylor,R.W.; Kubo,T.; Molecular cloning and biological characterization of novel antimicrobial peptides, pilosulin 3 and pilosulin 4, from a species of the Australian ant genus Myrmecia Arch. Biochem. Biophys. 428 (2), 170-178 (2004)