Allergen

BAF45320.1

Accession BAF45320.1
External DB Link NCBI Protein
Species Cryptomeria japonica
Common Name Japanese cedar
Description polygalacturonase, partial
IUIS Name Cry j 2
Length 65
Year Adopted 2009
Sequence >BAF45320.1 Cry j 2; polygalacturonase, partial [Cryptomeria japonica]
MAMKLIAPMAFLAMQLIIMAAAEDQSAQIMLDSVVEKYLRSNRSLRRVEHSRHDAINIFN
VEKYG
Parent Accession

Related Articles

Pubmed Authors Title Journal
8002972 Komiyama,N.; Sone,T.; Shimizu,K.; Morikubo,K.; Kino,K. cDNA cloning and expression of Cry j II the second major allergen of Japanese cedar pollen Biochem. Biophys. Res. Commun. 201 (2), 1021-1028 (1994)
2382797 Sakaguchi,M.; Inouye,S.; Taniai,M.; Ando,S.; Usui,M.; Matuhasi,T. Identification of the second major allergen of Japanese cedar pollen Allergy 45 (4), 309-312 (1990)
7926035 Namba,M.; Kurose,M.; Torigoe,K.; Hino,K.; Taniguchi,Y.; Fukuda,S.; Usui,M.; Kurimoto,M. Molecular cloning of the second major allergen, Cry j II, from Japanese cedar pollen FEBS Lett. 353 (2), 124-128 (1994)
14745225 Fujimura T; Shigeta S; Kawamoto S; Aki T; Masubuchi M; Hayashi T; Yoshizato K; Ono K Two-dimensional IgE-binding spectrum of Japanese cedar (Cryptomeria japonica) pollen allergens. Int Arch Allergy Immunol. 2004 Feb;133(2):125-35
17192717 Futamura,N.; Kusunoki,Y.; Mukai,Y.; Shinohara,K.; Characterization of genes for a pollen allergen, Cry j 2, of Cryptomeria japonica Int. Arch. Allergy Immunol. 143 (1), 59-68 (2007)
12580914 Tamura Y; Kawaguchi J; Serizawa N; Hirahara K; Shiraishi A; Nigi H; Taniguchi Y; Toda M; Inouye S; Takemori T; Sakaguchi M Analysis of sequential immunoglobulin E-binding epitope of Japanese cedar pollen allergen (Cry j 2) in humans, monkeys and mice. Clin Exp Allergy. 2003 Feb;33(2):211-7
2344038 Grabarek Z; Gergely J Zero-length crosslinking procedure with the use of active esters. Anal Biochem. 1990 Feb 15;185(1):131-5