Allergen

BAN29066.1

Accession BAN29066.1
External DB Link NCBI Protein
Species Triticum aestivum
Common Name wheat
Description gamma-gliadin
IUIS Name Tri a 20
Length 279
Year Adopted 2015
Sequence >BAN29066.1 Tri a 20; gamma-gliadin [Triticum aestivum]
NMQVDPSSQVQWPQQQPVPQPHQPFSQQPQQTFPQPQQTFPHQPQQQFPQPQQPQQQFLQ
PQQPFPQQPQQPYPQQPQQPFPQTQQPQQLFPQSQQPQQQFSQPQQQFPQPQQPQQSFPQ
QQPPFIQPSLQQQVNPCKNFLLQQCKPVSLVSSLWSMIWPQSDCQVMRQQCCQQLAQIPQ
QLQCAAIHTIIHSIIMQQEQQEQQQGMHILLPLYQQQQVGQGTLVQGQGIIQPQQPAQLE
AIRSLVLQTLPTMCNVYVPPECSIIKAPFSSVVAGIGGQ
Parent Accession

Related Articles

Pubmed Authors Title Journal
9738916 Maruyama,N.; Ichise,K.; Katsube,T.; Kishimoto,T.; Kawase,S.; Matsumura,Y.; Takeuchi,Y.; Sawada,T.; Utsumi,S. Identification of major wheat allergens by means of the Escherichia coli expression system Eur. J. Biochem. 255 (3), 739-745 (1998)
10.1016/0168-9452(88)90080-5 Scheets,K.; Hedgcoth,C. Nucleotide sequence of a gamma gliadin gene: Comparisons with other gamma gliadin sequences show the structure of gamma gliadin genes and the general primary structure of gamma gliadins Plant Sci. 57, 141-150 (1988)
3017812 Rafalski,J.A. Structure of wheat gamma-gliadin genes Gene 43 (3), 221-229 (1986)
16212427 Shan L; Qiao SW; Arentz-Hansen H; Molberg O; Gray GM; Sollid LM; Khosla C Identification and analysis of multivalent proteolytically resistant peptides from gluten: implications for celiac sprue. J Proteome Res. 2005 Sep-Oct;4(5):1732-41
12198706 Arentz-Hansen H; McAdam SN; Molberg O; Fleckenstein B; Lundin KE; Jorgensen TJ; Jung G; Roepstorff P; Sollid LM Celiac lesion T cells recognize epitopes that cluster in regions of gliadins rich in proline residues. Gastroenterology. 2002 Sep;123(3):803-9
14581135 Morita E; Matsuo H; Mihara S; Morimoto K; Savage AW; Tatham AS Fast omega-gliadin is a major allergen in wheat-dependent exercise-induced anaphylaxis. J Dermatol Sci. 2003 Nov;33(2):99-104