Allergen

CAA04829.1

Accession CAA04829.1
External DB Link NCBI Protein
Species Betula pendula
Common Name European white birch
Description pathogenesis related protein, PR-10, Bet v 1-like
IUIS Name Bet v 1
Length 159
Year Adopted 2007
Sequence >CAA04829.1 Bet v 1; pathogenesis related protein, PR-10, Bet v 1-like [Betula pendula]
GVFNYEIGATSVIPAARLFKAFILVGDNLFPKVAPQAISSVENIEGNGGPGTIKKISFPE
GFPFKYVKDRVDEVDHTNFKYSYSVIEGGPVGDTLEKISNEIKIVATPNGGSILKINNKY
HTKGDHEVKAEQIKASKEMGETLLRAVESYLLAHSDAYN
Parent Accession

Related Articles

Pubmed Authors Title Journal
10.1111/j.1365-3040.1995.tb00595.x Swoboda,I.; Scheiner,O.; Heberle-Bors,E.; Vicente,O. cDNA cloning and characterization of three genes in the Bet v 1 gene family that encode pathogenesis-related proteins Plant Cell Environ. 18, 865-874 (1995)
7852325 Swoboda,I.; Jilek,A.; Ferreira,F.; Engel,E.; Hoffmann-Sommergruber,K.; Scheiner,O.; Kraft,D.; Breiteneder,H.; Pittenauer,E.; Schmid,E.; Vicente,O.; Heberle-Bors,E.; Ahorn,H.; Breitenbach,M. Isoforms of Bet v 1, the major birch pollen allergen, analyzed by liquid chromatography, mass spectrometry, and cDNA cloning J. Biol. Chem. 270 (6), 2607-2613 (1995)
10509815 Friedl-Hajek,R.; Radauer,C.; O'Riordain,G.; Hoffmann-Sommergruber,K.; Leberl,K.; Scheiner,O.; Breiteneder,H. New Bet v 1 isoforms including a naturally occurring truncated form of the protein derived from Austrian birch pollen Mol. Immunol. 36 (10), 639-645 (1999)
2101127 Elsayed,S.; Vik,H. Purification and N-terminal amino acid sequence of two birch pollen isoallergens (Bet v I and Bet v II) Int. Arch. Allergy Appl. Immunol. 93 (4), 378-384 (1990)
15713985 Erdmann SM; Sachs B; Schmidt A; Merk HF; Scheiner O; Moll-Slodowy S; Sauer I; Kwiecien R; Maderegger B; Hoffmann-Sommergruber K In vitro analysis of birch-pollen-associated food allergy by use of recombinant allergens in the basophil activation test. Int Arch Allergy Immunol. 2005 Mar;136(3):230-8
12911423 Rossi RE; Monasterolo G; Monasterolo S Detection of specific IgE antibodies in the sera of patients allergic to birch pollen using recombinant allergens Bet v 1, Bet v 2, Bet v 4: evaluation of different IgE reactivity profiles. Allergy. 2003 Sep;58(9):929-32
12218371 Moverare R; Westritschnig K; Svensson M; Hayek B; Bende M; Pauli G; Sorva R; Haahtela T; Valenta R; Elfman L Different IgE reactivity profiles in birch pollen-sensitive patients from six European populations revealed by recombinant allergens: an imprint of local sensitization. Int Arch Allergy Immunol. 2002 Aug;128(4):325-35
2571499 Breiteneder H; Pettenburger K; Bito A; Valenta R; Kraft D; Rumpold H; Scheiner O; Breitenbach M The gene coding for the major birch pollen allergen Betv1, is highly homologous to a pea disease resistance response gene. EMBO J. 1989 Jul;8(7):1935-8
7751517 Ebner C; Hirschwehr R; Bauer L; Breiteneder H; Valenta R; Ebner H; Kraft D; Scheiner O Identification of allergens in fruits and vegetables: IgE cross-reactivities with the important birch pollen allergens Bet v 1 and Bet v 2 (birch profilin). J Allergy Clin Immunol. 1995 May;95(5 Pt 1):962-9
16820045 Schenk,M.F.; Gilissen,L.J.; Esselink,G.D.; Smulders,M.J.; Seven different genes encode a diverse mixture of isoforms of Bet v 1, the major birch pollen allergen (er) BMC Genomics 7 (1), 168 (2006)
8627171 Ferreira F; Hirtenlehner K; Jilek A; Godnik-Cvar J; Breiteneder H; Grimm R; Hoffmann-Sommergruber K; Scheiner O; Kraft D; Breitenbach M; Rheinberger HJ; Ebner C Dissection of immunoglobulin E and T lymphocyte reactivity of isoforms of the major birch pollen allergen Bet v 1: potential use of hypoallergenic isoforms for immunotherapy. J Exp Med. 1996 Feb 1;183(2):599-609
8366100 Ferreira FD; Hoffmann-Sommergruber K; Breiteneder H; Pettenburger K; Ebner C; Sommergruber W; Steiner R; Bohle B; Sperr WR; Valent P Purification and characterization of recombinant Bet v I, the major birch pollen allergen. Immunological equivalence to natural Bet v I. J Biol Chem. 1993 Sep 15;268(26):19574-80