Allergen

CAA04959.1

Accession CAA04959.1
External DB Link NCBI Protein
Species Aspergillus fumigatus
Common Name fungus
Description unknown function
IUIS Name Asp f 4
Length 286
Year Adopted 2007
Sequence >CAA04959.1 Asp f 4; unknown function [Aspergillus fumigatus]
GEVGDTVYATINGVLVSWINEWSGEAKTSDAPVSQATPVSNAVAAAAAASTPEPSSSHSD
SSSSSGVSADWTNTPAEGEYCTDGFGGRTEPSGSGIFYKGNVGKPWGSNIIEVSPENAKK
YKHVAQFVGSDTDPWTVVFWNKIGPDGGLTGWYGNSALTLHLEAGETKYVAFDENSQGAW
GAAKGDELPKDQFGGYSCTWGEFDFDSKINHGWSGWDVSAIQAENAHHEVQGMKICNHAG
ELCSIISHGLSKVIDAYTADLAGVDGIGGKVVPGPTRLVVNLDYKE
Parent Accession

Related Articles

Pubmed Authors Title Journal
8645976 Crameri,R.; Blaser,K. Cloning Aspergillus fumigatus allergens by the pJuFo filamentous phage display system Int. Arch. Allergy Immunol. 110 (1), 41-45 (1996)
10848921 Kurup VP; Banerjee B; Hemmann S; Greenberger PA; Blaser K; Crameri R Selected recombinant Aspergillus fumigatus allergens bind specifically to IgE in ABPA. Clin Exp Allergy. 2000 Jul;30(7):988-93
9565354 Hemmann S; Nikolaizik WH; Schoni MH; Blaser K; Crameri R Differential IgE recognition of recombinant Aspergillus fumigatus allergens by cystic fibrosis patients with allergic bronchopulmonary aspergillosis or Aspergillus allergy. Eur J Immunol. 1998 Apr;28(4):1155-60
10482834 Hemmann S; Menz G; Ismail C; Blaser K; Crameri R Skin test reactivity to 2 recombinant Aspergillus fumigatus allergens in A fumigatus-sensitized asthmatic subjects allows diagnostic separation of allergic bronchopulmonary aspergillosis from fungal sensitization. J Allergy Clin Immunol. 1999 Sep;104(3 Pt 1):601-7
14763934 Knutsen AP; Hutcheson PS; Slavin RG; Kurup VP IgE antibody to Aspergillus fumigatus recombinant allergens in cystic fibrosis patients with allergic bronchopulmonary aspergillosis. Allergy. 2004 Feb;59(2):198-203