Allergen

CAA06305.1

Accession CAA06305.1
External DB Link NCBI Protein
Species Aspergillus fumigatus
Common Name fungus
Description ribonuclease mitogillin, partial
IUIS Name Asp f 1
Length 125
Year Adopted 2007
Sequence >CAA06305.1 Asp f 1; ribonuclease mitogillin, partial [Aspergillus fumigatus]
RLVYNQAKAESNSHHAPLSDGKTGSSYPHWFTNGYDGDGKLIKGRMPIKFGKADCDRPPK
HGKDGMGKDDHYLLEFPTFPDGHDYKFDSKKPKEDPGPARVIYTYPNKVFCGIVAHERGN
QGDLR
Parent Accession

Related Articles

Pubmed Authors Title Journal
2230656 Arruda,L.K.; Platts-Mills,T.A.; Fox,J.W.; Chapman,M.D. Aspergillus fumigatus allergen I, a major IgE-binding protein, is a member of the mitogillin family of cytotoxins J. Exp. Med. 172 (5), 1529-1532 (1990)
1624793 Moser,M.; Crameri,R.; Menz,G.; Schneider,T.; Dudler,T.; Virchow,C.; Gmachl,M.; Blaser,K.; Suter,M. Cloning and expression of recombinant Aspergillus fumigatus allergen I/a (rAsp f I/a) with IgE binding and type I skin test activity J. Immunol. 149 (2), 454-460 (1992)
10656667 Sarma,P.V.; Purkayastha,S.; Madan,T.; Sarma,P.U. Expression of an epitopic region of AspfI, an allergen/antigen/cytotoxin of Aspergillus fumigatus Immunol. Lett. 70 (3), 151-155 (1999)
1431110 Arruda,L.K.; Mann,B.J.; Chapman,M.D. Selective expression of a major allergen and cytotoxin, Asp f I, in Aspergillus fumigatus. Implications for the immunopathogenesis of Aspergillus-related diseases J. Immunol. 149 (10), 3354-3359 (1992)
7508461 Moser M; Crameri R; Brust E; Suter M; Menz G Diagnostic value of recombinant Aspergillus fumigatus allergen I/a for skin testing and serology. J Allergy Clin Immunol. 1994 Jan;93(1 Pt 1):1-11
16499415 Ronning CM; Fedorova ND; Bowyer P; Coulson R; Goldman G; Kim HS; Turner G; Wortman JR; Yu J; Anderson MJ; Denning DW; Nierman WC Genomics of Aspergillus fumigatus. Rev Iberoam Micol. 2005 Dec;22(4):223-8
14763934 Knutsen AP; Hutcheson PS; Slavin RG; Kurup VP IgE antibody to Aspergillus fumigatus recombinant allergens in cystic fibrosis patients with allergic bronchopulmonary aspergillosis. Allergy. 2004 Feb;59(2):198-203