Allergen

CAA09884.1

Accession CAA09884.1
External DB Link NCBI Protein
Species Malassezia sympodialis
Common Name yeast
Description cyclophilin/peptidyl-prolyl isomerase
IUIS Name Mala s 6
Length 162
Year Adopted 2007
Sequence >CAA09884.1 Mala s 6; cyclophilin/peptidyl-prolyl isomerase [Malassezia sympodialis]
MSNVFFDITKNGAPLGTIKFKLFDDVVPKTAANFRALCTGEKGFGYAGSHFHRVIPDFML
QGGDFTAGNGTGGKSIYGAKFADENFQLKHNKPGLLSMANAGPNTNGSQFFITTVVTSWL
DGKHVVFGEVIDGMNVVKAIEAEGSGSGKPRSRIEIAKCGVC
Parent Accession

Related Articles

Pubmed Authors Title Journal
10469297 Lindborg,M.; Magnusson,C.G.; Zargari,A.; Schmidt,M.; Scheynius,A.; Crameri,R.; Whitley,P. Selective cloning of allergens from the skin colonizing yeast Malassezia furfur by phage surface display technology J. Invest. Dermatol. 113 (2), 156-161 (1999)
11753999 Fluckiger S; Fijten H; Whitley P; Blaser K; Crameri R Cyclophilins, a new family of cross-reactive allergens. Eur J Immunol. 2002 Jan;32(1):10-7
16483252 Glaser,A.G.; Limacher,A.; Fluckiger,S.; Scheynius,A.; Scapozza,L.; Crameri,R.; Analysis of the cross-reactivity and of the 1.5 A crystal structure of the Malassezia sympodialis Mala s 6 allergen, a member of the cyclophilin pan-allergen family Biochem. J. 396 (1), 41-49 (2006)