Allergen

CAA23681.1

Accession CAA23681.1
External DB Link NCBI Protein
Species Gallus gallus
Common Name chicken
Description ovalbumin
IUIS Name Gal d 2
Length 155
Year Adopted 2007
Sequence >CAA23681.1 Gal d 2; ovalbumin [Gallus gallus]
MGSIAAASMEFCFDVFKELKVHHANENIFYCPIAIMSALAMVYLGAKDSTRTQINKVVRF
DKLPGFGDSIEAQCGTSVNVHSSLRDILNQITKPNDVYSFSLASRLYAEERYPILPEYFQ
CVKELYRGGLEPINFQTAADQARELINSWVESQTN
Parent Accession

Related Articles

Pubmed Authors Title Journal
6601671 Hoffman DR Immunochemical identification of the allergens in egg white. J Allergy Clin Immunol. 1983 May;71(5):481-6
6638415 Langeland T A clinical and immunological study of allergy to hen Allergy. 1983 Oct;38(7):493-500
9275136 Urisu A; Ando H; Morita Y; Wada E; Yasaki T; Yamada K; Komada K; Torii S; Goto M; Wakamatsu T Allergenic activity of heated and ovomucoid-depleted egg white. J Allergy Clin Immunol. 1997 Aug;100(2):171-6
16045855 Walsh BJ; Hill DJ; Macoun P; Cairns D; Howden ME Detection of four distinct groups of hen egg allergens binding IgE in the sera of children with egg allergy. Allergol Immunopathol (Madr). 2005 Jul-Aug;33(4):183-91
8006309 Bernhisel-Broadbent J; Dintzis HM; Dintzis RZ; Sampson HA Allergenicity and antigenicity of chicken egg ovomucoid (Gal d III) compared with ovalbumin (Gal d I) in children with egg allergy and in mice. J Allergy Clin Immunol. 1994 Jun;93(6):1047-59
9404088 Wada E; Urisu A; Morita Y; Ando H; Yasaki T; Yamada K; Goto M; Wakamatsu T [Assessment of allergenic activity of heated and ovomucoid-depleted egg white] Arerugi. 1997 Oct;46(10):1007-12