Allergen

CAA25593.1

Accession CAA25593.1
External DB Link NCBI Protein
Species Triticum aestivum
Common Name wheat
Description gliadin
IUIS Name Tri a 21
Length 286
Year Adopted 2007
Sequence >CAA25593.1 Tri a 21; gliadin [Triticum aestivum]
MKTFLILVLLAIVATTATTAVRFPVPQLQPQNPSQQQPQEQVPLVQQQQFLGQQQPFPPQ
QPYPQPQPFPSQLPYLQLQPFPQPQLPYSQPQPFRPQQPYPQPQPQYSQPQQPISQQQQQ
QQQQQQQQQQQQQILQQILQQQLIPCMDVVLQQHNIAHGRSQVLQQSTYQLLQELCCQHL
WQIPEQSQCQAILKVVHAIILHQQQKQQQQPSSQVSFQQPLQQYPLGQGSFRPSQQNPQA
QGSVQPQQLPQFEEIRNLALQTLPAMCNVYIPPYCTIAPFGIFGTN
Parent Accession

Related Articles

Pubmed Authors Title Journal
9738916 Maruyama,N.; Ichise,K.; Katsube,T.; Kishimoto,T.; Kawase,S.; Matsumura,Y.; Takeuchi,Y.; Sawada,T.; Utsumi,S. Identification of major wheat allergens by means of the Escherichia coli expression system Eur. J. Biochem. 255 (3), 739-745 (1998)
9383251 Sandiford CP; Tatham AS; Fido R; Welch JA; Jones MG; Tee RD; Shewry PR; Newman Taylor AJ Identification of the major water/salt insoluble wheat proteins involved in cereal hypersensitivity. Clin Exp Allergy. 1997 Oct;27(10):1120-9
16403227 van Herpen TW; Goryunova SV; van der Schoot J; Mitreva M; Salentijn E; Vorst O; Schenk MF; van Veelen PA; Koning F; van Soest LJ; Vosman B; Bosch D; Hamer RJ; Gilissen LJ; Smulders MJ Alpha-gliadin genes from the A, B, and D genomes of wheat contain different sets of celiac disease epitopes. BMC Genomics. 2006 Jan 10;7:1
16212427 Shan L; Qiao SW; Arentz-Hansen H; Molberg O; Gray GM; Sollid LM; Khosla C Identification and analysis of multivalent proteolytically resistant peptides from gluten: implications for celiac sprue. J Proteome Res. 2005 Sep-Oct;4(5):1732-41
15876313 Battais F; Mothes T; Moneret-Vautrin DA; Pineau F; Kanny G; Popineau Y; Bodinier M; Denery-Papini S Identification of IgE-binding epitopes on gliadins for patients with food allergy to wheat. Allergy. 2005 Jun;60(6):815-21
16364168 Weichel M; Vergoossen NJ; Bonomi S; Scibilia J; Ortolani C; Ballmer-Weber BK; Pastorello EA; Crameri R Screening the allergenic repertoires of wheat and maize with sera from double-blind, placebo-controlled food challenge positive patients. Allergy. 2006 Jan;61(1):128-35
14581135 Morita E; Matsuo H; Mihara S; Morimoto K; Savage AW; Tatham AS Fast omega-gliadin is a major allergen in wheat-dependent exercise-induced anaphylaxis. J Dermatol Sci. 2003 Nov;33(2):99-104