Allergen

CAA35597.1

Accession CAA35597.1
External DB Link NCBI Protein
Species Triticum aestivum
Common Name wheat
Description alpha-amylase inhibitor
IUIS Name Tri a 30
Length 168
Year Adopted 2007
Sequence >CAA35597.1 Tri a 30; alpha-amylase inhibitor [Triticum aestivum]
MACKSSCSLLLLAAVLLSVLAAASASGSCVPGVAFRTNLLPHCRDYVLQQTCGTFTPGSK
LPEWMTSASIYSPGKPYLAKLYCCQELAEISQQCRCEALRYFIALPVPSQPVDPRSGNVG
ESGLIDLPGCPREMQWDFVRLLVAPGQCNLATIHNVRYCPAVEQPLWI
Parent Accession

Related Articles

Pubmed Authors Title Journal
2102861 Garcia-Maroto,F.; Marana,C.; Mena,M.; Garcia-Olmedo,F.; Carbonero,P. Cloning of cDNA and chromosomal location of genes encoding the three types of subunits of the wheat tetrameric inhibitor of insect alpha-amylase Plant Mol. Biol. 14 (5), 845-853 (1990)
8334538 Armentia A; Sanchez-Monge R; Gomez L; Barber D; Salcedo G In vivo allergenic activities of eleven purified members of a major allergen family from wheat and barley flour. Clin Exp Allergy. 1993 May;23(5):410-5
10717358 Kusaba-Nakayama M; Ki M; Iwamoto M; Shibata R; Sato M; Imaizumi K CM3, one of the wheat alpha-amylase inhibitor subunits, and binding of IgE in sera from Japanese with atopic dermatitis related to wheat. Food Chem Toxicol. 2000 Feb-Mar;38(2-3):179-85