Allergen

CAA42646.1

Accession CAA42646.1
External DB Link NCBI Protein
Species Glycine max
Common Name soybean
Description pathogenesis related protein, PR-10, Bet v 1-like
IUIS Name Gly m 4
Length 158
Year Adopted 2007
Sequence >CAA42646.1 Gly m 4; pathogenesis related protein, PR-10, Bet v 1-like [Glycine max]
MGVFTFEDEINSPVAPATLYKALVTDADNVIPKALDSFKSVENVEGNGGPGTIKKITFLE
DGETKFVLHKIESIDEANLGYSYSVVGGAALPDTAEKITFDSKLVAGPNGGSAGKLTVKY
ETKGDAEPNQDELKTGKAKADALFKAIEAYLLAHPDYN
Parent Accession

Related Articles

Pubmed Authors Title Journal
12417891 Kleine-Tebbe J; Vogel L; Crowell DN; Haustein UF; Vieths S Severe oral allergy syndrome and anaphylactic reactions caused by a Bet v 1- related PR-10 protein in soybean, SAM22. J Allergy Clin Immunol. 2002 Nov;110(5):797-804
14713921 Mittag D; Vieths S; Vogel L; Becker WM; Rihs HP; Helbling A; Wuthrich B; Ballmer-Weber BK Soybean allergy in patients allergic to birch pollen: clinical investigation and molecular characterization of allergens. J Allergy Clin Immunol. 2004 Jan;113(1):148-54
18834331 Berkner,H.; Neudecker,P.; Mittag,D.; Ballmer-Weber,B.K.; Schweimer,K.; Vieths,S.; Rosch,P.; Cross-reactivity of pollen and food allergens: soybean Gly m 4 is a member of the Bet v 1 superfamily and closely resembles yellow lupine proteins Biosci. Rep. 29 (3), 183-192 (2009)