Allergen

CAA51775.1

Accession CAA51775.1
External DB Link NCBI Protein
Species Lolium perenne
Common Name perennial ryegrass
Description expansin
IUIS Name Lol p 2
Length 88
Year Adopted 2007
Sequence >CAA51775.1 Lol p 2; expansin [Lolium perenne]
EFTVEKGSDEKNLALSIKYSKEGDAMAEVELKEHGSNEWLALKKNGDGVWEIKSDKPLKG
PFNFRFVSEKGMWNVFDDVVPADFKVGT
Parent Accession

Related Articles

Pubmed Authors Title Journal
7691817 Sidoli,A.; Tamborini,E.; Giuntini,I.; Levi,S.; Volonte,G.; Paini,C.; De Lalla,C.; Siccardi,A.G.; Baralle,F.E.; Galliani,S.; Arosio,P. Cloning, expression, and immunological characterization of recombinant Lolium perenne allergen Lol p II J. Biol. Chem. 268 (29), 21819-21825 (1993)
3680810 Freidhoff LR; Ehrlich-Kautzky E; Meyers DA; Marsh DG A study of the human immune response to Lolium perenne (rye) pollen and its components, Lol p I and Lol p II (Rye I and Rye II). II. Longitudinal variation of antibody levels in relation to symptomatology and pollen exposure and correction of seasonally elevated antibody levels to basal values. J Allergy Clin Immunol. 1987 Nov;80(5):646-55
9117883 Van Ree R; Van Leeuwen WA; Dieges PH; Van Wijk RG; De Jong N; Brewczyski PZ; Kroon AM; Schilte PP; Tan KY; Simon-Licht IF; Roberts AM; Stapel SO; Aalberse RC Measurement of IgE antibodies against purified grass pollen allergens (Lol p 1, 2, 3 and 5) during immunotherapy. Clin Exp Allergy. 1997 Jan;27(1):68-74
3782681 Freidhoff LR; Ehrlich-Kautzky E; Grant JH; Meyers DA; Marsh DG A study of the human immune response to Lolium perenne (rye) pollen and its components, Lol p I and Lol p II (rye I and rye II). I. Prevalence of reactivity to the allergens and correlations among skin test, IgE antibody, and IgG antibody data. J Allergy Clin Immunol. 1986 Dec;78(6):1190-201