Allergen

CAA53529.1

Accession CAA53529.1
External DB Link NCBI Protein
Species Phleum pratense
Common Name common timothy
Description expansin
IUIS Name Phl p 2
Length 122
Year Adopted 2007
Sequence >CAA53529.1 Phl p 2; expansin [Phleum pratense]
MSMASSSSSSLLAMAVLAALFAGAWCVPKVTFTVEKGSNEKHLAVLVKYEGDTMAEVELR
EHGSDEWVAMTKGEGGVWTFDSEEPLQGPFNFRFLTEKGMKNVFDDVVPEKYTIGATYAP
EE
Parent Accession

Related Articles

Pubmed Authors Title Journal
8262175 Dolecek,C.; Vrtala,S.; Laffer,S.; Steinberger,P.; Kraft,D.; Scheiner,O.; Valenta,R. Molecular characterization of Phl p II, a major timothy grass (Phleum pratense) pollen allergen FEBS Lett. 335 (3), 299-304 (1993)
9500760 Niederberger V; Laffer S; Froschl R; Kraft D; Rumpold H; Kapiotis S; Valenta R; Spitzauer S IgE antibodies to recombinant pollen allergens (Phl p 1, Phl p 2, Phl p 5, and Bet v 2) account for a high percentage of grass pollen-specific IgE. J Allergy Clin Immunol. 1998 Feb;101(2 Pt 1):258-64
10726734 Rossi RE; Monasterolo G; Operti D; Operti R; Berlen R Evaluation of IgE antibodies to recombinant pollen allergens (Phl p 1, Phl p 2, and Phl p 5) in a random sample of patients with specific IgE to Phleum pratense. Allergy. 2000 Feb;55(2):181-4
15286445 Rossi RE; Monasterolo G Evaluation of recombinant and native timothy pollen (rPhl p 1, 2, 5, 6, 7, 11, 12 and nPhl p 4)- specific IgG4 antibodies induced by subcutaneous immunotherapy with timothy pollen extract in allergic patients. Int Arch Allergy Immunol. 2004 Sep;135(1):44-53
12534548 Mari A Skin test with a timothy grass (Phleum pratense) pollen extract vs. IgE to a timothy extract vs. IgE to rPhl p 1, rPhl p 2, nPhl p 4, rPhl p 5, rPhl p 6, rPhl p 7, rPhl p 11, and rPhl p 12: epidemiological and diagnostic data. Clin Exp Allergy. 2003 Jan;33(1):43-51