Allergen

CAA54587.1

Accession CAA54587.1
External DB Link NCBI Protein
Species Parietaria judaica
Common Name pellitory
Description lipid transfer protein
IUIS Name Par j 1
Length 133
Year Adopted 2015
Sequence >CAA54587.1 Par j 1; lipid transfer protein [Parietaria judaica]
MVRALMPCLPFVQGKEKEPSKGCCSGAKRLDGETKTGPQRVHACECIQTAMKTYSDIDGK
LVSEVPKHCGIVDSKLPPIDVNMDCKTVGVVPRQPQLPVSLRHGPVTGPSDPAHKARLER
PQIRVPPPAPEKA
Parent Accession

Related Articles

Pubmed Authors Title Journal
9104790 Duro,G.; Colombo,P.; Assunta Costa,M.; Izzo,V.; Porcasi,R.; Di Fiore,R.; Locorotondo,G.; Cocchiara,R.; Geraci,D. Isolation and characterization of two cDNA clones coding for isoforms of the Parietaria judaica major allergen Par j 1.0101 Int. Arch. Allergy Immunol. 112 (4), 348-355 (1997)
8556571 Ayuso R; Carreira J; Polo F Quantitation of the major allergen of several Parietaria pollens by an anti-Par 1 monoclonal antibody-based ELISA. Analysis of crossreactivity among purified Par j 1, Par o 1 and Par m 1 allergens. Clin Exp Allergy. 1995 Oct;25(10):993-9
15347375 Lombardero M; Garcia-Selles FJ; Polo F; Jimeno L; Chamorro MJ; Garcia-Casado G; Sanchez-Monge R; Diaz-Perales A; Salcedo G; Barber D Prevalence of sensitization to Artemisia allergens Art v 1, Art v 3 and Art v 60 kDa. Cross-reactivity among Art v 3 and other relevant lipid-transfer protein allergens. Clin Exp Allergy. 2004 Sep;34(9):1415-21