Allergen

CAA59338.1

Accession CAA59338.1
External DB Link NCBI Protein
Species Triticum aestivum
Common Name wheat
Description LMW glutenin
IUIS Name Tri a 36
Length 229
Year Adopted 2007
Sequence >CAA59338.1 Tri a 36; LMW glutenin [Triticum aestivum]
FALIAVVATSTIAQMETSCIPGLERPWQQQPLPPQQTLFPQQQPFPQQQPPFSQQQPSFS
QQQPPFSQQQPILPEPPFSLQQQPVLPQQSPFSQQQLVLPPQQQQQLPQQQISIVQPSVL
QQLNPCKVFLQQQCSPVAMPQRLARSQMWQQSRCHVMQQQCCQQLSQIPEQSRYDAICAI
TYSIILQEQQQGFVQAQQQQPQQSGQGVSQSQQQSQQQLGQCSFQQPQQ
Parent Accession

Related Articles

Pubmed Authors Title Journal
9738916 Maruyama,N.; Ichise,K.; Katsube,T.; Kishimoto,T.; Kawase,S.; Matsumura,Y.; Takeuchi,Y.; Sawada,T.; Utsumi,S. Identification of major wheat allergens by means of the Escherichia coli expression system Eur. J. Biochem. 255 (3), 739-745 (1998)
14581135 Morita E; Matsuo H; Mihara S; Morimoto K; Savage AW; Tatham AS Fast omega-gliadin is a major allergen in wheat-dependent exercise-induced anaphylaxis. J Dermatol Sci. 2003 Nov;33(2):99-104
20357483 Bouchez-Mahiout I; Snégaroff J; Tylichova M; Pecquet C; Branlard G; Laurière M Low molecular weight glutenins in wheat-dependant, exercise-induced anaphylaxis: allergenicity and antigenic relationships with omega 5-gliadins. Int Arch Allergy Immunol. 2010;153(1):35-45