Allergen

CAA60628.1

Accession CAA60628.1
External DB Link NCBI Protein
Species Betula pendula
Common Name European white birch
Description calcium-binding protein, polcalcin
IUIS Name Bet v 4
Length 85
Year Adopted 2015
Sequence >CAA60628.1 Bet v 4; calcium-binding protein, polcalcin [Betula pendula]
MADDHPQDKAERERIFKRFDANGDGKISAAELGEALKTLGSITPDEVKHMMAEIDTDGDG
FISFQEFTDFGRANRGLLKDVAKIF
Parent Accession

Related Articles

Pubmed Authors Title Journal
9345295 Twardosz,A.; Hayek,B.; Seiberler,S.; Vangelista,L.; Elfman,L.; Gronlund,H.; Kraft,D.; Valenta,R. Molecular characterization, expression in Escherichia coli, and epitope analysis of a two EF-hand calcium-binding birch pollen allergen, Bet v 4 Biochem. Biophys. Res. Commun. 239 (1), 197-204 (1997)
15037075 Neudecker,P.; Nerkamp,J.; Eisenmann,A.; Nourse,A.; Lauber,T.; Schweimer,K.; Lehmann,K.; Schwarzinger,S.; Ferreira,F.; Rosch,P.; Solution structure, dynamics, and hydrodynamics of the calcium-bound cross-reactive birch pollen allergen Bet v 4 reveal a canonical monomeric two EF-hand assembly with a regulatory function J. Mol. Biol. 336 (5), 1141-1157 (2004)
12911423 Rossi RE; Monasterolo G; Monasterolo S Detection of specific IgE antibodies in the sera of patients allergic to birch pollen using recombinant allergens Bet v 1, Bet v 2, Bet v 4: evaluation of different IgE reactivity profiles. Allergy. 2003 Sep;58(9):929-32
12218371 Moverare R; Westritschnig K; Svensson M; Hayek B; Bende M; Pauli G; Sorva R; Haahtela T; Valenta R; Elfman L Different IgE reactivity profiles in birch pollen-sensitive patients from six European populations revealed by recombinant allergens: an imprint of local sensitization. Int Arch Allergy Immunol. 2002 Aug;128(4):325-35