Allergen

CAA61943.2

Accession CAA61943.2
External DB Link NCBI Protein
Species Triticum aestivum
Common Name wheat
Description profilin, partial
IUIS Name Tri a 12
Length 131
Year Adopted 2015
Sequence >CAA61943.2 Tri a 12; profilin, partial [Triticum aestivum]
MSWQTYVDDHLCCEIDGQHLTSAAILGHDGSVWTESPNFPKFKPEEIAGIVKDFEEPGHL
APTGLFLGGTKYMVIQGEPGVVIRGKKGTGGITIKKTGMALILGIYDEPMTPGQCNLVVE
RLGDYLIDQGY
Parent Accession

Related Articles

Pubmed Authors Title Journal
7920020 Rihs,H.P.; Rozynek,P.; May-Taube,K.; Welticke,B.; Baur,X. Polymerase chain reaction based cDNA cloning of wheat profilin: a potential plant allergen Int. Arch. Allergy Immunol. 105 (2), 190-194 (1994)
16364168 Weichel M; Vergoossen NJ; Bonomi S; Scibilia J; Ortolani C; Ballmer-Weber BK; Pastorello EA; Crameri R Screening the allergenic repertoires of wheat and maize with sera from double-blind, placebo-controlled food challenge positive patients. Allergy. 2006 Jan;61(1):128-35
19210348 Constantin C; Quirce S; Poorafshar M; Touraev A; Niggemann B; Mari A; Ebner C; Akerström H; Heberle-Bors E; Nystrand M; Valenta R Micro-arrayed wheat seed and grass pollen allergens for component-resolved diagnosis. Allergy. 2009 Jul;64(7):1030-7