Allergen

CAA73720.1

Accession CAA73720.1
External DB Link NCBI Protein
Species Mercurialis annua
Common Name annual mercury grass
Description profilin
IUIS Name Mer a 1
Length 133
Year Adopted 2007
Sequence >CAA73720.1 Mer a 1; profilin [Mercurialis annua]
MSWQTYVDDHLMCDIDGQGQHLAAASIVGHDGSIWAQSASFPQLKPEEITGIMKDFDEPG
HLAPTGLYIAGTKYMVIQGESGAVIRGKKGSGGITIKKTGQALVFGIYEEPVTPGQCNMV
VERLGDYLIEQGM
Parent Accession

Related Articles

Pubmed Authors Title Journal
9104791 Vallverdu A; Garcia-Ortega P; Martinez J; Martinez A; Esteban MI; de Molina M; Fernandez-Tavora L; Fernandez J; Bartolome B; Palacios R Mercurialis annua: characterization of main allergens and cross-reactivity with other species. Int Arch Allergy Immunol. 1997 Apr;112(4):356-64
14677902 Singh AB; Kumar P Aeroallergens in clinical practice of allergy in India. An overview. Ann Agric Environ Med. 2003;10(2):131-6
12001793 Palosuo T; Panzani RC; Singh AB; Ariano R; Alenius H; Turjanmaa K Allergen cross-reactivity between proteins of the latex from Hevea brasiliensis, seeds and pollen of Ricinus communis, and pollen of Mercurialis annua, members of the Euphorbiaceae family. Allergy Asthma Proc. 2002 Mar-Apr;23(2):141-7
9525453 Vallverdu,A.; Asturias,J.A.; Arilla,M.C.; Gomez-Bayon,N.; Martinez,A.; Martinez,J.; Palacios,R.; Characterization of recombinant Mercurialis annua major allergen Mer a 1 (profilin) J. Allergy Clin. Immunol. 101 (3), 363-370 (1998)