Allergen

CAA75312.1

Accession CAA75312.1
External DB Link NCBI Protein
Species Hevea brasiliensis
Common Name Para rubber tree
Description profilin
IUIS Name Hev b 8
Length 131
Year Adopted 2007
Sequence >CAA75312.1 Hev b 8; profilin [Hevea brasiliensis]
MSWQTYVDERLMCEIEGNHLTAAAIIGQDGSVWAQSSNFPQFKSEEITAIMSDFDEPGTL
APTGLHLGGTKYMVIQGEAGAVIRGKKGPGGVTVRKTNQALIIGIYDEPMTPGQCNMIVE
RLGDYLLEQGM
Parent Accession

Related Articles

Pubmed Authors Title Journal
10955696 Rihs,H.P.; Chen,Z.; Rozynek,P.; Baur,X.; Lundberg,M.; Cremer,R. PCR-based cloning, isolation, and IgE-binding properties of recombinant latex profilin (rHev b 8) Allergy 55 (8), 712-717 (2000)
15627782 Wagner S; Breiteneder H Hevea brasiliensis latex allergens: current panel and clinical relevance. Int Arch Allergy Immunol. 2005 Jan;136(1):90-7
10828719 Yip L; Hickey V; Wagner B; Liss G; Slater J; Breiteneder H; Sussman G; Beezhold D Skin prick test reactivity to recombinant latex allergens. Int Arch Allergy Immunol. 2000 Apr;121(4):292-9
16618365 Sanz ML; Garcia-Aviles MC; Tabar AI; Anda M; Garcia BE; Barber D; Salcedo G; Rihs HP; Raulf-Heimsoth M Basophil Activation Test and specific IgE measurements using a panel of recombinant natural rubber latex allergens to determine the latex allergen sensitization profile in children. Pediatr Allergy Immunol. 2006 Mar;17(2):148-56