Allergen

CAA76887.1

Accession CAA76887.1
External DB Link NCBI Protein
Species Phleum pratense
Common Name common timothy
Description calcium-binding protein, polcalcin
IUIS Name Phl p 7
Length 78
Year Adopted 2010
Sequence >CAA76887.1 Phl p 7; calcium-binding protein, polcalcin [Phleum pratense]
MADDMERIFKRFDTNGDGKISLSELTDALRTLGSTSADEVQRMMAEIDTDGDGFIDFNEF
ISFCNANPGLMKDVAKVF
Parent Accession

Related Articles

Pubmed Authors Title Journal
10224228 Niederberger,V.; Hayek,B.; Vrtala,S.; Laffer,S.; Twardosz,A.; Vangelista,L.; Sperr,W.R.; Valent,P.; Rumpold,H.; Kraft,D.; Ehrenberger,K.; Valenta,R.; Spitzauer,S. Calcium-dependent immunoglobulin E recognition of the apo- and calcium-bound form of a cross-reactive two EF-hand timothy grass pollen allergen, Phl p 7 FASEB J. 13 (8), 843-856 (1999)