Allergen

CAA81613.1

Accession CAA81613.1
External DB Link NCBI Protein
Species Phleum pratense
Common Name common timothy
Description beta-expansin
IUIS Name Phl p 1
Length 263
Year Adopted 2007
Sequence >CAA81613.1 Phl p 1; beta-expansin [Phleum pratense]
MASSSSVLLVVALFAVFLGSAHGIPKVPPGPNITATYGDKWLDAKSTWYGKPTAAGPKDN
GGACGYKDVDKPPFSGMTGCGNTPIFKSGRGCGSCFEIKCTKPEACSGEPVVVHITDDNE
EPIAAYHFDLSGIAFGSMAKKGDEQKLRSAGEVEIQFRRVKCKYPEGTKVTFHVEKGSNP
NYLALLVKFVAGDGDVVAVDIKEKGKDKWIALKESWGAIWRIDTPEVLKGPFTVRYTTEG
GTKGEAKDVIPEGWKADTAYESK
Parent Accession

Related Articles

Pubmed Authors Title Journal
7930302 Laffer,S.; Valenta,R.; Vrtala,S.; Susani,M.; van Ree,R.; Kraft,D.; Scheiner,O.; Duchene,M. Complementary DNA cloning of the major allergen Phl p I from timothy grass (Phleum pratense); recombinant Phl p I inhibits IgE binding to group I allergens from eight different grass species J. Allergy Clin. Immunol. 94 (4), 689-698 (1994)
1597349 Valenta R; Vrtala S; Ebner C; Kraft D; Scheiner O Diagnosis of grass pollen allergy with recombinant timothy grass (Phleum pratense) pollen allergens. Int Arch Allergy Immunol. 1992;97(4):287-94
9500760 Niederberger V; Laffer S; Froschl R; Kraft D; Rumpold H; Kapiotis S; Valenta R; Spitzauer S IgE antibodies to recombinant pollen allergens (Phl p 1, Phl p 2, Phl p 5, and Bet v 2) account for a high percentage of grass pollen-specific IgE. J Allergy Clin Immunol. 1998 Feb;101(2 Pt 1):258-64
9066506 Boutin Y; Lamontagne P; Boulanger J; Brunet C; Hebert J Immunological and biological properties of recombinant Lol p 1. Int Arch Allergy Immunol. 1997 Mar;112(3):218-25
15634345 Ball T; Edstrom W; Mauch L; Schmitt J; Leistler B; Fiebig H; Sperr WR; Hauswirth AW; Valent P; Kraft D; Almo SC; Valenta R Gain of structure and IgE epitopes by eukaryotic expression of the major Timothy grass pollen allergen, Phl p 1. FEBS J. 2005 Jan;272(1):217-27