Allergen

CAB02209.1

Accession CAB02209.1
External DB Link NCBI Protein
Species Carpinus betulus
Common Name hornbeam
Description pathogenesis related protein, PR-10, Bet v 1-like
IUIS Name Car b 1
Length 160
Year Adopted 2015
Sequence >CAB02209.1 Car b 1; pathogenesis related protein, PR-10, Bet v 1-like [Carpinus betulus]
MGVFNYEAETPSVIPAARLFKSYVLDFDKLIPKVAPQAISSVENVGGNGGPGTIKNITFA
EGSPFKFVKERVDEVDNANFKYNYTVIEGDVLGDKLEKVSHELKIVAAPGGGSIVKISSK
FHAKGDHEVNAEEMKGAKEMAEKLLRAVESYLLAHTAEYN
Parent Accession

Related Articles

Pubmed Authors Title Journal
1603091 Larsen,J.N.; Stroman,P.; Ipsen,H. PCR based cloning and sequencing of isogenes encoding the tree pollen major allergen Car b I from Carpinus betulus, hornbeam Mol. Immunol. 29 (6), 703-711 (1992)
1961201 Ipsen,H.; Hansen,O.C. The NH2-terminal amino acid sequence of the immunochemically partial identical major allergens of Alder (Alnus glutinosa) Aln g I, birch (Betula verrucosa) Bet v I, hornbeam (Carpinus betulus) Car b I and oak (Quercus alba) Que a I pollens Mol. Immunol. 28 (11), 1279-1288 (1991)
19170672 Wallner M; Erler A; Hauser M; Klinglmayr E; Gadermaier G; Vogel L; Mari A; Bohle B; Briza P; Ferreira F Immunologic characterization of isoforms of Car b 1 and Que a 1, the major hornbeam and oak pollen allergens. Allergy. 2009 Mar;64(3):452-60
7542079 Lowenstein,H.; Sparholt,S.H.; Klysner,S.S.; Ipsen,H.; Larsen,J.N.; The significance of isoallergenic variations in present and future specific immunotherapy Int. Arch. Allergy Immunol. 107 (1-3), 285-289 (1995)