Allergen

CAB64344.1

Accession CAB64344.1
External DB Link NCBI Protein
Species Lolium perenne
Common Name perennial ryegrass
Description unknown function
IUIS Name Lol p 5
Length 301
Year Adopted 2007
Sequence >CAB64344.1 Lol p 5; unknown function [Lolium perenne]
MAVQKYTVALFLAVALVAGPADSYAADAGYTPAAAATPATPAATPAAGGGKATTDEQKLL
EDVNAGFKAAVAADANAPPADKFKIFEAAFSESCKGLLATSDAKAPGLILKLDTDYDVAY
KAGEGATPEAKYDAFVTALTEALRVIAGALEVHAVKPATEEVPAAKIPTGELQIVDKIDA
AFKIAATAANAAPTNDKFTVFESAFNKALKECTGGAYETYKFIPSLEAAVKQAYATTVAA
APEVKYAVFEAALTKAITAMSQAQKVAKPAAAAATGAATVATGAATAAAGGATAAAGGYK
A
Parent Accession

Related Articles

Pubmed Authors Title Journal
8262382 Ong,E.K.; Griffith,I.J.; Knox,R.B.; Singh,M.B. Cloning of a cDNA encoding a group-V (group-IX) allergen isoform from rye-grass pollen that demonstrates specific antigenic immunoreactivity Gene 134 (2), 235-240 (1993)
1671715 Singh,M.B.; Hough,T.; Theerakulpisut,P.; Avjioglu,A.; Davies,S.; Smith,P.M.; Taylor,P.; Simpson,R.J.; Ward,L.D.; McCluskey,J.; Puy,R.; Knox,R.B. Isolation of cDNA encoding a newly identified major allergenic protein of rye-grass pollen: intracellular targeting to the amyloplast Proc. Natl. Acad. Sci. U.S.A. 88 (4), 1384-1388 (1991)
10622741 Suphioglu,C.; Mawdsley,D.; Schappi,G.; Gruehn,S.; de Leon,M.; Rolland,J.M.; O'Hehir,R.E. Molecular cloning, expression and immunological characterisation of Lol p 5C, a novel allergen isoform of rye grass pollen demonstrating high IgE reactivity FEBS Lett. 462 (3), 435-441 (1999)
9117883 Van Ree R; Van Leeuwen WA; Dieges PH; Van Wijk RG; De Jong N; Brewczyski PZ; Kroon AM; Schilte PP; Tan KY; Simon-Licht IF; Roberts AM; Stapel SO; Aalberse RC Measurement of IgE antibodies against purified grass pollen allergens (Lol p 1, 2, 3 and 5) during immunotherapy. Clin Exp Allergy. 1997 Jan;27(1):68-74
11782018 Swoboda I; De Weerd N; Bhalla PL; Niederberger V; Sperr WR; Valent P; Kahlert H; Fiebig H; Verdino P; Keller W; Ebner C; Spitzauer S; Valenta R; Singh MB Mutants of the major ryegrass pollen allergen, Lol p 5, with reduced IgE-binding capacity: candidates for grass pollen-specific immunotherapy. Eur J Immunol. 2002 Jan;32(1):270-80