Allergen

CAD32318.1

Accession CAD32318.1
External DB Link NCBI Protein
Species Malus domestica
Common Name apple
Description pathogenesis related protein, PR-10, Bet v 1-like
IUIS Name Mal d 1
Length 158
Year Adopted 2007
Sequence >CAD32318.1 Mal d 1; pathogenesis related protein, PR-10, Bet v 1-like [Malus domestica]
GVYTYENEYTSEIPPPRLFKAFVLDADNLIPKIAPQAIKHAEILEGDGGPGTIKKITFGE
GSQYGYVKHKIDSVDEANYSYAYTLIEGDALTDTIEKVSYETKLVASGSGSIIKSISHYH
TKGDVEIMEEHVKAGKEKAHGLFKLIESYLKDHPDAYN
Parent Accession

Related Articles

Pubmed Authors Title Journal
8543755 Hsieh,L.S.; Moos,M. Jr.; Lin,Y. Characterization of apple 18 and 31 kd allergens by microsequencing and evaluation of their content during storage and ripening J. Allergy Clin. Immunol. 96 (6 PT 1), 960-970 (1995)
7677763 Vanek-Krebitz,M.; Hoffmann-Sommergruber,K.; Laimer da Camara Machado,M.; Susani,M.; Ebner,C.; Kraft,D.; Scheiner,O.; Breiteneder,H. Cloning and sequencing of Mal d 1, the major allergen from apple (Malus domestica), and its immunological relationship to Bet v 1, the major birch pollen allergen Biochem. Biophys. Res. Commun. 214 (2), 538-551 (1995)
9332353 Hoffmann-Sommergruber,K.; Vanek-Krebitz,M.; Radauer,C.; Wen,J.; Ferreira,F.; Scheiner,O.; Breiteneder,H. Genomic characterization of members of the Bet v 1 family: genes coding for allergens and pathogenesis-related proteins share intron positions Gene 197 (1-2), 91-100 (1997)
11419722 Holm,J.; Baerentzen,G.; Gajhede,M.; Ipsen,H.; Larsen,J.N.; Lowenstein,H.; Wissenbach,M.; Spangfort,M.D. Molecular basis of allergic cross-reactivity between group 1 major allergens from birch and apple J. Chromatogr. B Biomed. Sci. Appl. 756 (1-2), 307-313 (2001)
7549498 Fahlbusch,B.; Rudeschko,O.; Muller,W.D.; Schlenvoigt,G.; Vettermann,S.; Jager,L. Purification and characterization of the major allergen from apple and its allergenic cross-reactivity with Bet v 1 Int. Arch. Allergy Immunol. 108 (2), 119-126 (1995)
10.1016/S0168-9452(99)00222-8 Puehringer,H.; Moll,D.; Hoffmann-Sommergruber,K.; Watillon,B.; Katinger,H.; Laimer da Camara Machado,M. The promoter of an apple Ypr10 gene, encoding the major allergen Mal d 1, is stress- and pathogen-inducible Plant Sci. 152 (1), 35-50 (2000)
7518715 Vieths,S.; Schoning,B.; Petersen,A.; Characterization of the 18-kDa apple allergen by two-dimensional immunoblotting and microsequencing Int. Arch. Allergy Immunol. 104 (4), 399-404 (1994)
16393331 Bolhaar ST; Zuidmeer L; Ma Y; Ferreira F; Bruijnzeel-Koomen CA; Hoffmann-Sommergruber K; van Ree R; Knulst AC A mutant of the major apple allergen, Mal d 1, demonstrating hypo-allergenicity in the target organ by double-blind placebo-controlled food challenge. Clin Exp Allergy. 2005 Dec;35(12):1638-44
15883791 Gao ZS; van de Weg WE; Schaart JG; Schouten HJ; Tran DH; Kodde LP; van der Meer IM; van der Geest AH; Kodde J; Breiteneder H; Hoffmann-Sommergruber K; Bosch D; Gilissen LJ Genomic cloning and linkage mapping of the Mal d 1 (PR-10) gene family in apple (Malus domestica). Theor Appl Genet. 2005 Jun;111(1):171-83
10502033 Son DY; Scheurer S; Hoffmann A; Haustein D; Vieths S Pollen-related food allergy: cloning and immunological analysis of isoforms and mutants of Mal d 1, the major apple allergen, and Bet v 1, the major birch pollen allergen. Eur J Nutr. 1999 Aug;38(4):201-15