Allergen

CAD80019.1

Accession CAD80019.1
External DB Link NCBI Protein
Species Plantago lanceolata
Common Name narrow-leaved plantain
Description Ole e 1-like
IUIS Name Pla l 1
Length 65
Year Adopted 2007
Sequence >CAD80019.1 Pla l 1; Ole e 1-like [Plantago lanceolata]
MVKLTQVAAILLIGAFFLIASTSIATQTSHPAKFHVEGEVYCNVCHSRNLINELSERMAG
AQVQL
Parent Accession

Related Articles

Pubmed Authors Title Journal
12646046 Calabozo,B.; Diaz-Perales,A.; Salcedo,G.; Barber,D.; Polo,F. Cloning and expression of biologically active Plantago lanceolata pollen allergen Pla l 1 in the yeast Pichia pastoris Biochem. J. 372 (Pt 3), 889-896 (2003)
11251634 Calabozo B; Barber D; Polo F Purification and characterization of the main allergen of Plantago lanceolata pollen, Pla l 1. Clin Exp Allergy. 2001 Feb;31(2):322-30
12569985 Calabozo B; Barber D; Polo F Studies on the carbohydrate moiety of Pla l 1 allergen. identification of a major N-glycan and significance for the immunoglobulin E-binding activity. Clin Exp Allergy. 2002 Nov;32(11):1628-34