Allergen

CAI64400.1

Accession CAI64400.1
External DB Link NCBI Protein
Species Zea mays
Common Name corn
Description thioredoxin
IUIS Name Zea m 25
Length 128
Year Adopted 2007
Sequence >CAI64400.1 Zea m 25; thioredoxin [Zea mays]
MAASEAAAAAATPVAPTEGTVIAIHSLEEWSIQIEEANSAKKLVVIDFTATWCPPCRAMA
PIFADMAKKSPNVVFLKVDVDEMKTIAEQFSVEAMPTFLFMREGDVKDRVVGAAKEELAR
KLELHMAS
Parent Accession

Related Articles

Pubmed Authors Title Journal
16364168 Weichel M; Vergoossen NJ; Bonomi S; Scibilia J; Ortolani C; Ballmer-Weber BK; Pastorello EA; Crameri R Screening the allergenic repertoires of wheat and maize with sera from double-blind, placebo-controlled food challenge positive patients. Allergy. 2006 Jan;61(1):128-35
16522470 Weichel M; Glaser AG; Ballmer-Weber BK; Schmid-Grendelmeier P; Crameri R Wheat and maize thioredoxins: a novel cross-reactive cereal allergen family related to baker J Allergy Clin Immunol. 2006 Mar;117(3):676-81
19367736 Fasoli E; Pastorello EA; Farioli L; Scibilia J; Aldini G; Carini M; Marocco A; Boschetti E; Righetti PG Searching for allergens in maize kernels via proteomic tools. J Proteomics. 2009 Apr 13;72(3):501-10
22417217 Pahr S; Constantin C; Mari A; Scheiblhofer S; Thalhamer J; Ebner C; Vrtala S; Mittermann I; Valenta R Molecular characterization of wheat allergens specifically recognized by patients suffering from wheat-induced respiratory allergy. Clin Exp Allergy. 2012 Apr;42(4):597-609