Allergen

CAL07989.1

Accession CAL07989.1
External DB Link NCBI Protein
Species Platanus acerifolia
Common Name London plane tree
Description lipid transfer protein
IUIS Name Pla a 3
Length 118
Year Adopted 2016
Sequence >CAL07989.1 Pla a 3; lipid transfer protein [Platanus acerifolia]
MAFSRVAKLACLLLACMVATAPHAEAAITCGTVVTRLTPCLTFLRSGGAVAPACCNGVKA
LNNDAKTTPDRQAACGCLKTASTSISGIQLGNAASLAGKCGVNLPYKISPTIDCSKVK
Parent Accession

Related Articles

Pubmed Authors Title Journal
17250699 Lauer I; Miguel-Moncin MS; Abel T; Foetisch K; Hartz C; Fortunato D; Cistero-Bahima A; Vieths S; Scheurer S Identification of a plane pollen lipid transfer protein (Pla a 3) and its immunological relation to the peach lipid-transfer protein, Pru p 3. Clin Exp Allergy. 2007 Feb;37(2):261-9
N/A: See Journal Wangorsch et al Pla a 3_0201 Allergy 70 Supplement
26892183 Wangorsch A, Larsson H, Messmer M, García-Moral A, Lauer I, Wolfheimer S, Schülke S, Bartra J, Vieths S, Lidholm J, Scheurer S. Molecular cloning of plane pollen allergen Pla a 3 and its utility as diagnostic marker for peach associated plane pollen allergy. Clin Exp Allergy. 2016 May;46(5):764-74. doi: 10.1111/cea.12721.
28656246 Ni WW, Wang LB, Zhou YJ, Cao MD, Huang W, Guo M, Ji CM, Sun JL, Wei JF. Expression, purification and epitope analysis of Pla a 3 allergen from Platanus acerifolia pollen. Mol Med Rep. 2017 Sep;16(3):2851-2855. doi: 10.3892/mmr.2017.6867. Epub 2017 Jun 28.