Allergen

CAP17694.1

Accession CAP17694.1
External DB Link NCBI Protein
Species Lepidorhombus whiffiagonis
Common Name flat fish
Description calcium-binding protein, parvalbumin
IUIS Name Lep w 1
Length 109
Year Adopted 2010
Sequence >CAP17694.1 Lep w 1; calcium-binding protein, parvalbumin [Lepidorhombus whiffiagonis]
MTFAGLDAAEIKAALDGCAAADSFDYKKFFGACGLAKKSAEEVKAAFNKIDQDESGFIEE
DELKLFLQNFSASARALTDKETANFLKAGDVDGDGKIGIEEFTDLVRSK
Parent Accession

Related Articles

Pubmed Authors Title Journal
19796207 Griesmeier U; Vázquez-Cortés S; Bublin M; Radauer C; Ma Y; Briza P; Fernández-Rivas M; Breiteneder H Expression levels of parvalbumins determine allergenicity of fish species. Allergy. 2009 Oct 1;
19937851 Griesmeier U, Bublin M, Radauer C, Vázquez-Cortés S, Ma Y, Fernández-Rivas M, Breiteneder H. Physicochemical properties and thermal stability of Lep w 1, the major allergen of whiff. Mol Nutr Food Res. 2010 Jun;54(6):861-9.