Allergen

CAQ68366.1

Accession CAQ68366.1
External DB Link NCBI Protein
Species Sardinops sagax
Common Name South American pilchard
Description calcium-binding protein, parvalbumin
IUIS Name Sar sa 1
Length 109
Year Adopted 2010
Sequence >CAQ68366.1 Sar sa 1; calcium-binding protein, parvalbumin [Sardinops sagax]
MALAGLVKEADITAALEACKAADSFDHKAFFHKVGMSGKSADELKKAFAIIDQDKSGFIE
EEELKLFLQNFCKKARALTDGETKKFLKAGDNVGDGKIGIDEFNHLVKH
Parent Accession

Related Articles

Pubmed Authors Title Journal
19616851 Beale JE; Jeebhay MF; Lopata AL Characterisation of purified parvalbumin from five fish species and nucleotide sequencing of this major allergen from Pacific pilchard, Sardinops sagax. Mol Immunol. 2009 Sep;46(15):2985-93