Allergen

CAR82266.1

Accession CAR82266.1
External DB Link NCBI Protein
Species Triticum aestivum
Common Name wheat
Description LMW glutenin
IUIS Name
Length 272
Year Adopted 2010
Sequence >CAR82266.1 LMW glutenin [Triticum aestivum]
MGRLLSPRGKELHTPQEQFPQQQQFPQPQQFPQQQILQQHQIPQQPQQFPQQQQFLQQQQ
IPQQQIPQQHQIPQQPQQFPQQQFPQQQQFPQQHQSPQQQFPQQQFPQQQLPQQEFSQQQ
ISQQPQQLPQQQQIPQQPQQFLQQQQFPQQQPPQQHQFPQQQLPQQQQIPQQQQIPQQPQ
QIPQQQQIPQQPKQFPQQQFPQQQFPQQQFPQQEFPQQQQFPQQQIAQQPQQLPQQQFPI
PYPPQQSQEPSPYQQYPQQQPSGSDVISICGL
Parent Accession

Related Articles

Pubmed Authors Title Journal
10329828 Palosuo,K.; Alenius,H.; Varjonen,E.; Koivuluhta,M.; Mikkola,J.; Keskinen,H.; Kalkkinen,N.; Reunala,T. A novel wheat gliadin as a cause of exercise-induced anaphylaxis J. Allergy Clin. Immunol. 103 (5 Pt 1), 912-917 (1999)
16339549 Matsuo H; Kohno K; Niihara H; Morita E Specific IgE determination to epitope peptides of omega-5 gliadin and high molecular weight glutenin subunit is a useful tool for diagnosis of wheat-dependent exercise-induced anaphylaxis. J Immunol. 2005 Dec 15;175(12):8116-22
16128812 Matsuo H; Kohno K; Morita E Molecular cloning, recombinant expression and IgE-binding epitope of omega-5 gliadin, a major allergen in wheat-dependent exercise-induced anaphylaxis. FEBS J. 2005 Sep;272(17):4431-8
14699123 Matsuo H; Morita E; Tatham AS; Morimoto K; Horikawa T; Osuna H; Ikezawa Z; Kaneko S; Kohno K; Dekio S Identification of the IgE-binding epitope in omega-5 gliadin, a major allergen in wheat-dependent exercise-induced anaphylaxis. J Biol Chem. 2004 Mar 26;279(13):12135-40
11590393 Palosuo K; Varjonen E; Kekki OM; Klemola T; Kalkkinen N; Alenius H; Reunala T Wheat omega-5 gliadin is a major allergen in children with immediate allergy to ingested wheat. J Allergy Clin Immunol. 2001 Oct;108(4):634-8
14581135 Morita E; Matsuo H; Mihara S; Morimoto K; Savage AW; Tatham AS Fast omega-gliadin is a major allergen in wheat-dependent exercise-induced anaphylaxis. J Dermatol Sci. 2003 Nov;33(2):99-104