Allergen

CAT99612.1

Accession CAT99612.1
External DB Link NCBI Protein
Species Malus domestica
Common Name apple
Description thaumatin-like
IUIS Name Mal d 2
Length 158
Year Adopted 2010
Sequence >CAT99612.1 Mal d 2; thaumatin-like [Malus domestica]
ASRSVDAPSPWSGRFWGRTRCSTDAAGKFTCETADCGSGQVACNGAGAVPPATLVEITIA
ANGGQDYYDVSLVDGFNLPMYVAPQGGTGECKPSSCPANVNMACPAQLQVKAADGSVISC
KSACLAFGDSKYCCTPPNDTPETCPPTEYSEIFEKQCP
Parent Accession

Related Articles

Pubmed Authors Title Journal
8543755 Hsieh,L.S.; Moos,M. Jr.; Lin,Y. Characterization of apple 18 and 31 kd allergens by microsequencing and evaluation of their content during storage and ripening J. Allergy Clin. Immunol. 96 (6 PT 1), 960-970 (1995)
12787673 Krebitz M; Wagner B; Ferreira F; Peterbauer C; Campillo N; Witty M; Kolarich D; Steinkellner H; Scheiner O; Breiteneder H Plant-based heterologous expression of Mal d 2, a thaumatin-like protein and allergen of apple (Malus domestica), and its characterization as an antifungal protein. J Mol Biol. 2003 Jun 13;329(4):721-30
10737193 OH,D.H.; Song,K.J.; Shin,Y.U.; Chung,W.I.; Isolation of a cDNA encoding a 31-kDa, pathogenesis-related 5/thaumatin-like (PR5/TL) protein abundantly expressed in apple fruit (Nalus domestica cv. Fuji) Biosci. Biotechnol. Biochem. 64 (2), 355-362 (2000)
12481992 Venisse,J.S.; Malnoy,M.; Faize,M.; Paulin,J.P.; Brisset,M.N.; Modulation of defense responses of Malus spp. during compatible and incompatible interactions with Erwinia amylovora Mol. Plant Microbe Interact. 15 (12), 1204-1212 (2002)
18617748 Smole U; Bublin M; Radauer C; Ebner C; Breiteneder H Mal d 2, the thaumatin-like allergen from apple, is highly resistant to gastrointestinal digestion and thermal processing. Int Arch Allergy Immunol. 2008;147(4):289-98
18683825 Oberhuber C; Ma Y; Marsh J; Rigby N; Smole U; Radauer C; Alessandri S; Briza P; Zuidmeer L; Maderegger B; Himly M; Sancho AI; van Ree R; Knulst A; Ebner C; Shewry P; Mills EN; Wellner K; Breiteneder H; Hoffmann-Sommergruber K; Bublin M Purification and characterisation of relevant natural and recombinant apple allergens. Mol Nutr Food Res. 2008 Nov;52 Suppl 2:S208-19