Allergen

CBA13559.1

Accession CBA13559.1
External DB Link NCBI Protein
Species Triticum aestivum
Common Name wheat
Description alpha-amylase inhibitor
IUIS Name Tri a 29
Length 120
Year Adopted 2011
Sequence >CBA13559.1 Tri a 29; alpha-amylase inhibitor [Triticum aestivum]
TGPYCYPGMGLPSNPLEGCREYVAQQTCGVGIVGSPVSTEPGNTPRDRCCKELYDASQHC
WCEAVRYFIGRTSDPNSGVLKDLPGCPREPQRDSAKVLVTPGHCNVMTVHNTPYCLGLDI
Parent Accession

Related Articles

Pubmed Authors Title Journal
2102861 Garcia-Maroto,F.; Marana,C.; Mena,M.; Garcia-Olmedo,F.; Carbonero,P. Cloning of cDNA and chromosomal location of genes encoding the three types of subunits of the wheat tetrameric inhibitor of insect alpha-amylase Plant Mol. Biol. 14 (5), 845-853 (1990)
1893104 Gautier,M.F.; Alary,R.; Lullien,V.; Joudrier,P. Nucleotide sequence of a cDNA clone encoding the wheat (Triticum durum Desf.) CM2 protein Plant Mol. Biol. 16 (2), 333-334 (1991)
8334538 Armentia A; Sanchez-Monge R; Gomez L; Barber D; Salcedo G In vivo allergenic activities of eleven purified members of a major allergen family from wheat and barley flour. Clin Exp Allergy. 1993 May;23(5):410-5