Allergen

E1U332.1

Accession E1U332.1
External DB Link NCBI Protein
Species Olea europaea
Common Name olive
Description isoflavon reductase-like protein, phenylcoumaran benzylic ether reductase
IUIS Name Ole e 12
Length 308
Year Adopted 2014
Sequence >E1U332.1 Ole e 12; isoflavon reductase-like protein, phenylcoumaran benzylic ether reductase [Olea europaea]
MADKTKILIIGGTGYIGKFIVEASAKSEHPTFALARESTISDPVKGKIIQGFKNSGVTIL
TGDLYDHESLVKAIKQVDVVISTVGQLQLADQVKIIAAIKEAGNVKRFFPSDFGTDVDRC
HAVEPAKSSFEIKSQIRRAIEAEGIPYTFVSANYFAGYSLPTLVQPEVTAPPRDKVIILG
DGNAKAVFNEENDIGTYTIKAVDDARTLNKILYIKPPKNIYSFNELVALWEKKIGKTLEK
IYVPEEQVLKQIQESPFPINIVMAINHSAFVKGDLTNFKIEPSFGVEASELYPDVKYTTV
EEYLDQFV
Parent Accession

Related Articles

Pubmed Authors Title Journal
22385802 Esteve,C.; Montealegre,C.; Marina,M.L.; Garcia,M.C.; Analysis of olive allergens Talanta 92, 1-14 (2012)
24154826 Jimenez-Lopez JC; Kotchoni SO; Hernandez-Soriano MC; Gachomo EW; Alché JD Structural functionality, catalytic mechanism modeling and molecular allergenicity of phenylcoumaran benzylic ether reductase, an olive pollen (Ole e 12) allergen. J Comput Aided Mol Des. 2013 Oct;27(10):873-95
23920474 Villalba M; Rodríguez R; Batanero E The spectrum of olive pollen allergens. From structures to diagnosis and treatment. Methods. 2014 Mar 1;66(1):44-54
6194915 Blanca M; Boulton P; Brostoff J; Gonzalez-Reguera I Studies of the allergens of Olea europea pollen. Clin Allergy. 1983 Sep;13(5):473-8
26391288 Castro L; Crespo JF; Rodríguez J; Rodríguez R; Villalba M Immunoproteomic tools are used to identify masked allergens: Ole e 12, an allergenic isoflavone reductase from olive (Olea europaea) pollen. Biochim Biophys Acta. 2015 Dec;1854(12):1871-80