Allergen

E3SU11.1

Accession E3SU11.1
External DB Link NCBI Protein
Species Olea europaea
Common Name olive
Description thaumatin-like
IUIS Name Ole e 13
Length 226
Year Adopted 2014
Sequence >E3SU11.1 Ole e 13; thaumatin-like [Olea europaea]
MNFSKNLPLLVSLWAITFFAYTHAATFDIVNQCTYTVWAAASPGGGRRLDQGQSWNINVA
PGTTQARIWGRTNCNFDANGRGQCETGDCNGLLECQGYGRPPNTLAEFALNQPNNLDFVD
ISNVDGFNIPLEFSPTTNVCRRLVCNAPIVQQCPSELRTPGGCNNPCTVFNTNEYCCTNG
PGSCGPTPLSRFFKERCPDAYSYPQDDPTSLFTCPAGTNYRVVFCP
Parent Accession

Related Articles

Pubmed Authors Title Journal
18354115 Palomares O; Alcántara M; Quiralte J; Villalba M; Garzón F; Rodríguez R Airway disease and thaumatin-like protein in an olive-oil mill worker. N Engl J Med. 2008 Mar 20;358(12):1306-8
22385802 Esteve,C.; Montealegre,C.; Marina,M.L.; Garcia,M.C.; Analysis of olive allergens Talanta 92, 1-14 (2012)
21995844 Esteve,C.; Canas,B.; Moreno-Gordaliza,E.; Del Rio,C.; Garcia,M.C.; Marina,M.L.; Identification of olive (Olea europaea) pulp proteins by matrix-assisted laser desorption/ionization time-of-flight mass spectrometry and nano-liquid chromatography tandem mass spectrometry J. Agric. Food Chem. 59 (22), 12093-12101 (2011)