Allergen

FG438715.1

Accession FG438715.1
External DB Link NCBI Protein
Species Actinidia deliciosa
Common Name green kiwifruit
Description profilin
IUIS Name Act d 9
Length 109
Year Adopted 2016
Sequence >FG438715.1 Act d 9; profilin [Actinidia deliciosa]
MSWQTYVDDHLMCEIEGNYLTSAAIIGQDGSIWAQSASFPQFKPEEITAIMNDFSEPGTL
APTGLYLGGTKYMVIQGEAGAVIRGKKGPGGVTVKKTNQALIIGIYDEP
Parent Accession
Notes Previous accession # in past versions of COMPARE was 100 (manual entry). An NCBI accession number for this sequence has now been identified: FG438715.1. Accession number updated accordingly (January 2020).

Related Articles

Pubmed Authors Title Journal
20061012 Bublin M; Pfister M; Radauer C; Oberhuber C; Bulley S; Dewitt AM; Lidholm J; Reese G; Vieths S; Breiteneder H; Hoffmann-Sommergruber K; Ballmer-Weber BK Component-resolved diagnosis of kiwifruit allergy with purified natural and recombinant kiwifruit allergens. J Allergy Clin Immunol. 2010 Mar;125(3):687-94, 694.e1
21083775 Bublin M; Dennstedt S; Buchegger M; Antonietta Ciardiello M; Bernardi ML; Tuppo L; Harwanegg C; Hafner C; Ebner C; Ballmer-Weber BK; Knulst A; Hoffmann-Sommergruber K; Radauer C; Mari A; Breiteneder H The performance of a component-based allergen microarray for the diagnosis of kiwifruit allergy. Clin Exp Allergy. 2011 Jan;41(1):129-36
23394996 Bublin M Kiwifruit allergies. Adv Food Nutr Res. 2013;68:321-40
23141741 Le TM; Bublin M; Breiteneder H; Fernández-Rivas M; Asero R; Ballmer-Weber B; Barreales L; Bures P; Belohlavkova S; de Blay F; Clausen M; Dubakiene R; Gislason D; van Hoffen E; Jedrzejczak-Czechowicz M; Kowalski ML; Kralimarkova T; Lidholm J; DeWitt AM; Mills CE; Papadopoulos NG; Popov T; Purohit A; van Ree R; Seneviratne S; Sinaniotis A; Summers C; Vázquez-Cortés S; Vieths S; Vogel L; Hoffmann-Sommergruber K; Knulst AC Kiwifruit allergy across Europe: clinical manifestation and IgE recognition patterns to kiwifruit allergens. J Allergy Clin Immunol. 2013 Jan;131(1):164-71