Allergen

NP_851372.1

Accession NP_851372.1
External DB Link NCBI Protein
Species Bos taurus
Common Name cow
Description alphaS1-casein
IUIS Name Bos d 9
Length 214
Year Adopted 2008
Sequence >NP_851372.1 Bos d 9; alphaS1-casein [Bos taurus]
MKLLILTCLVAVALARPKHPIKHQGLPQEVLNENLLRFFVAPFPEVFGKEKVNELSKDIG
SESTEDQAMEDIKQMEAESISSSEEIVPNSVEQKHIQKEDVPSERYLGYLEQLLRLKKYK
VPQLEIVPNSAEERLHSMKEGIHAQQKEPMIGVNQELAYFYPELFRQFYQLDAYPSGAWY
YVPLGTQYTDAPSFSDIPNPIGSENSEKTTMPLW
Parent Accession

Related Articles

Pubmed Authors Title Journal
6897774 Willis,I.M.; Stewart,A.F.; Caputo,A.; Thompson,A.R.; Mackinlay,A.G. Construction and identification by partial nucleotide sequence analysis of bovine casein and beta-lactoglobulin cDNA clones DNA 1 (4), 375-386 (1982)
10.1271/bbb1961.48.1663 Nagao,M.; Maki,M.; Sasaki,R.; Chiba,R. Isolation and sequence analysis of bovine alpha-s1-casein cDNA clone Agric. Biol. Chem. 48, 1663-1667 (1984)
8836334 Spuergin P; Mueller H; Walter M; Schiltz E; Forster J Allergenic epitopes of bovine alpha S1-casein recognized by human IgE and IgG. Allergy. 1996 May;51(5):306-12
15672476 Natale M; Bisson C; Monti G; Peltran A; Garoffo LP; Valentini S; Fabris C; Bertino E; Coscia A; Conti A Cow Mol Nutr Food Res. 2004 Oct;48(5):363-9
15932382 Shek LP; Bardina L; Castro R; Sampson HA; Beyer K Humoral and cellular responses to cow milk proteins in patients with milk-induced IgE-mediated and non-IgE-mediated disorders. Allergy. 2005 Jul;60(7):912-9
11174208 Chatchatee P; Jarvinen KM; Bardina L; Beyer K; Sampson HA Identification of IgE- and IgG-binding epitopes on alpha(s1)-casein: differences in patients with persistent and transient cow J Allergy Clin Immunol. 2001 Feb;107(2):379-83
1375126 Räsänen L; Lehto M; Reunala T Diagnostic value of skin and laboratory tests in cow Clin Exp Allergy. 1992 Mar;22(3):385-90