Allergen

P02224.2

Accession P02224.2
External DB Link NCBI Protein
Species Chironomus thummi thummi
Common Name midge
Description hemoglobin
IUIS Name Chi t 3
Length 162
Year Adopted 2007
Sequence >P02224.2 Chi t 3; hemoglobin [Chironomus thummi thummi]
MKFLVLALCIAAASAAVLTTEQADLVKKTWSTVKFNEVDILYAVFKAYPDIMAKFPQFAG
KDLDSIKDSAAFATHATRIVSFLSEVISLAGSDANIPAIQNLAKELATSHKPRGVSKDQF
TEFRTALFTYLKAHINFDGPTETAWTLALDTTYAMLFSAMDS
Parent Accession

Related Articles

Pubmed Authors Title Journal
1701849 Mazur G; Baur X; Liebers V Hypersensitivity to hemoglobins of the Diptera family Chironomidae: structural and functional studies of their immunogenic/allergenic sites. Monogr Allergy. 1990;28:121-37
6172457 Baur X; Dewair M; Fruhmann G; Aschauer H; Pfletschinger J; Braunitzer G Hypersensitivity to chironomids (non-biting midges): localization of the antigenic determinants within certain polypeptide sequences of hemoglobins (erythrocruorins) of Chironomus thummi thummi (Diptera). J Allergy Clin Immunol. 1982 Jan;69(1 Pt 1):66-76
2464134 Mazur G; Baur X; Modrow S; Becker WM A common epitope on major allergens from non-biting midges (Chironomidae). Mol Immunol. 1988 Oct;25(10):1005-10