Allergen

P02604.3

Accession P02604.3
External DB Link NCBI Protein
Species Gallus gallus
Common Name chicken
Description myosin light chain
IUIS Name Gal d 7
Length 192
Year Adopted 2016
Sequence >P02604.3 Gal d 7; myosin light chain [Gallus gallus]
MAPKKDVKKPAAAAAPAPAPAPAPAPAPAKPKEPAIDLKSIKIEFSKEQQDDFKEAFLLF
DRTGDAKITLSQVGDIVRALGQNPTNAEINKILGNPSKEEMNAKKITFEEFLPMLQAAAN
NKDQGTFEDFVEGLRVFDKEGNGTVMGAELRHVLATLGEKMTEEEVEELMKGQEDSNGCI
NYEAFVKHIMSV
Parent Accession

Related Articles

Pubmed Authors Title Journal
6709041 Nabeshima,Y.; Fujii-Kuriyama,Y.; Muramatsu,M.; Ogata,K.; Alternative transcription and two modes of splicing results in two myosin light chains from one gene Nature 308 (5957), 333-338 (1984)
7238855 Matsuda,G.; Maita,T.; Umegane,T.; The primary structure of L-1 light chain of chicken fast skeletal muscle myosin and its genetic implication FEBS Lett. 126 (1), 111-113 (1981)
7173826 Umegane,T.; Maita,T.; Matsuda,G.; Amino-acid sequence of the L-1 light chain of chicken fast skeletal-muscle myosin Hoppe-Seyler's Z. Physiol. Chem. 363 (11), 1321-1330 (1982)
6128725 Nabeshima,Y.; Fujii-Kuriyama,Y.; Muramatsu,M.; Ogata,K.; Molecular cloning and nucleotide sequences of the complementary DNAs to chicken skeletal muscle myosin two alkali light chain mRNAs Nucleic Acids Res. 10 (19), 6099-6110 (1982)
3979397 Henry,G.D.; Trayer,I.P.; Brewer,S.; Levine,B.A.; The widespread distribution of alpha-N-trimethylalanine as the N-terminal amino acid of light chains from vertebrate striated muscle myosins Eur. J. Biochem. 148 (1), 75-82 (1985)
8316857 Rayment,I.; Rypniewski,W.R.; Schmidt-Base,K.; Smith,R.; Tomchick,D.R.; Benning,M.M.; Winkelmann,D.A.; Wesenberg,G.; Holden,H.M.; Three-dimensional structure of myosin subfragment-1: a molecular motor Science 261 (5117), 50-58 (1993)
N/A: See Journal Klug C, Hemmer W, Focke M, Wank H, Quirce S, Gaubitzer E, Swoboda I Identification and characterization of the muscle protein, myosin light chain 1, as a major chicken meat allergen EAACI posters 1649 Klug
N/A: See Journal Klug C, Swoboda I EAACI poster chicken Myosin light chain Poster 1649 Allergy 70 Supplement 2015