Allergen

P23110.1

Accession P23110.1
External DB Link NCBI Protein
Species Helianthus annuus
Common Name sunflower
Description 2S albumin, conglutin
IUIS Name
Length 141
Year Adopted 2009
Sequence >P23110.1 2S albumin, conglutin [Helianthus annuus]
MARFSIVFAAAGVLLLVAMAPVSEASTTTIITTIIEENPYGRGRTESGCYQQMEEAEMLN
HCGMYLMKNLGERSQVSPRMREEDHKQLCCMQLKNLDEKCMCPAIMMMLNEPMWIRMRDQ
VMSMAHNLPIECNLMSQPCQM
Parent Accession

Related Articles

Pubmed Authors Title Journal
12421566 Alcocer,M.J.; Murtagh,G.J.; Bailey,K.; Dumoulin,M.; Meseguer,A.S.; Parker,M.J.; Archer,D.B. The disulphide mapping, folding and characterisation of recombinant Ber e 1, an allergenic protein, and SFA8, two sulphur-rich 2S plant albumins J. Mol. Biol. 324 (1), 165-175 (2002)
10858987 Kelly JD; Hefle SL 2S methionine-rich protein (SSA) from sunflower seed is an IgE-binding protein. Allergy. 2000 Jun;55(6):556-60
10686505 Kelly JD; Hlywka JJ; Hefle SL Identification of sunflower seed IgE-binding proteins. Int Arch Allergy Immunol. 2000 Jan;121(1):19-24
12911791 Murtagh GJ; Archer DB; Dumoulin M; Ridout S; Matthews S; Arshad SH; Alcocer MJ In vitro stability and immunoreactivity of the native and recombinant plant food 2S albumins Ber e 1 and SFA-8. Clin Exp Allergy. 2003 Aug;33(8):1147-52
15552720 Asero R; Mistrello G; Roncarolo D; Amato S Airborne allergy to sunflower seed. J Investig Allergol Clin Immunol. 2004;14(3):244-6