Allergen

P35779.2

Accession P35779.2
External DB Link NCBI Protein
Species Solenopsis richteri
Common Name black fire ant
Description unknown function
IUIS Name Sol r 3
Length 211
Year Adopted 2007
Sequence >P35779.2 Sol r 3; unknown function [Solenopsis richteri]
TNYCNLQSCKRNNAIHTMCQYTSPTPGPMCLEYSNVGFTDAEKDAIVNKHNELRQRVASG
KEMRGTNGPQPPAVKMPNLTWDPELATIAQRWANQCTFEHDACRNVERFAVGQNIAATSS
SGKNKSTLSDMILLWYNEVKDFDNRWISSFPSDGNILMHVGHYTQIVWAKTKKIGCGRIM
FKEDNWNKHYLVCNYGPAGNVLGAQIYEIKK
Parent Accession

Related Articles

Pubmed Authors Title Journal
8423273 Hoffman,D.R. Allergens in Hymenoptera venom XXIV: the amino acid sequences of imported fire ant venom allergens Sol i II, Sol i III, and Sol i IV J. Allergy Clin. Immunol. 91 (1 Pt 1), 71-78 (1993)
2355158 Hoffman,D.R.; Smith,A.M.; Schmidt,M.; Moffitt,J.E.; Guralnick,M. Allergens in Hymenoptera venom. XXII. Comparison of venoms from two species of imported fire ants, Solenopsis invicta and richteri J. Allergy Clin. Immunol. 85 (6), 988-996 (1990)
9389299 Hoffman,D.R. Reactions to less common species of fire ants J. Allergy Clin. Immunol. 100 (5), 679-683 (1997)
3192865 Hoffman DR; Dove DE; Jacobson RS Allergens in Hymenoptera venom. XX. Isolation of four allergens from imported fire ant (Solenopsis invicta) venom. J Allergy Clin Immunol. 1988 Nov;82(5 Pt 1):818-27
12789229 Caplan EL; Ford JL; Young PF; Ownby DR Fire ants represent an important risk for anaphylaxis among residents of an endemic region. J Allergy Clin Immunol. 2003 Jun;111(6):1274-7
12708984 Schmidt,M.; McConnell,T.J.; Hoffman,D.R.; Immunologic characterization of the recombinant fire ant venom allergen Sol i 3 Allergy 58 (4), 342-349 (2003)