Allergen

P35780.1

Accession P35780.1
External DB Link NCBI Protein
Species Polistes fuscatus
Common Name paper wasp
Description unknown function, antigen 5
IUIS Name Pol f 5
Length 205
Year Adopted 2007
Sequence >P35780.1 Pol f 5; unknown function, antigen 5 [Polistes fuscatus]
VDYCKIKCSSGIHTVCQYGESTKPSKNCADKVIKSVGPTEEEKKLIVNEHNRFRQKVAQG
LETRGNPGPQPAASDMNNLVWNDELAHIAQVWASQCQILVHDKCRNTAKYQVGQNIAYAG
GSKLPDVVSLIKLWENEVKDFNYNKGITKQNFGKVGHYTQMIWAKTKEIGCGSLKYMKNN
MQHHYLICNYGPAGNYLGQLPYTKK
Parent Accession

Related Articles

Pubmed Authors Title Journal
8454859 Lu,G.; Villalba,M.; Coscia,M.R.; Hoffman,D.R.; King,T.P. Sequence analysis and antigenic cross-reactivity of a venom allergen, antigen 5, from hornets, wasps, and yellow jackets J. Immunol. 150 (7), 2823-2830 (1993)
14572904 Pantera,B.; Hoffman,D.R.; Carresi,L.; Cappugi,G.; Turillazzi,S.; Manao,G.; Severino,M.; Spadolini,I.; Orsomando,G.; Moneti,G.; Pazzagli,L.; Characterization of the major allergens purified from the venom of the paper wasp Polistes gallicus Biochim. Biophys. Acta 1623 (2-3), 72-81 (2003)
3989146 Hoffman DR Allergens in Hymenoptera venom XIV: IgE binding activities of venom proteins from three species of vespids. J Allergy Clin Immunol. 1985 May;75(5):606-10
7065471 Hoffman DR; McDonald CA Allergens in hymenoptera venom. IX. Species specificity to Polistes (paper wasp) venoms. Ann Allergy. 1982 Feb;48(2):82-6
11342623 King TP; Jim SY; Monsalve RI; Kagey-Sobotka A; Lichtenstein LM; Spangfort MD Recombinant allergens with reduced allergenicity but retaining immunogenicity of the natural allergens: hybrids of yellow jacket and paper wasp venom allergen antigen 5s. J Immunol. 2001 May 15;166(10):6057-65
16197464 Bilo BM; Rueff F; Mosbech H; Bonifazi F; Oude-Elberink JN; the EAACI Interest Group on Insect Venom Hypersensitivity* Diagnosis of Hymenoptera venom allergy. Allergy. 2005 Nov;60(11):1339-49
6811646 Reisman RE; Wypych JI; Mueller UR; Grant JA Comparison of the allergenicity and antigenicity of Polistes venom and other vespid venoms. J Allergy Clin Immunol. 1982 Oct;70(4):281-7